DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nesd and SKIP5

DIOPT Version :9

Sequence 1:NP_610025.1 Gene:nesd / 35298 FlyBaseID:FBgn0032848 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001326222.1 Gene:SKIP5 / 824613 AraportID:AT3G54480 Length:274 Species:Arabidopsis thaliana


Alignment Length:241 Identity:53/241 - (21%)
Similarity:89/241 - (36%) Gaps:83/241 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 VKPESKVQLSNTLQDVLSICQSNDDILLSPGEHTIKFLEHLND--NGSL---------------- 374
            :||.|...|:|.          :|..|:    |.:.||..:.|  |.:|                
plant    27 MKPYSLTSLNNL----------DDGCLM----HILSFLSPIPDRYNTALVCHRWRYLACHPRLWL 77

  Fly   375 ------RGLTQPEAILSPAADLSLLPVVCSSDEDSTLLVIDGDYTLSELVLDCRHVRRGILLRNG 433
                  :.|:||...|:..:.:|     .:...|:.|:|..|:|.:|.:     .:::.:     
plant    78 RVDRFVKDLSQPGVFLNIESAVS-----AARPGDTILIVAGGNYRVSNI-----QIKKPL----- 127

  Fly   434 TLTMRGCRLLGDGSSSTQEGIVCMPG--ASVELKS-CLIENFAVGVSMRPKSSAELGSVQFKTCK 495
                  | |:|.|....:..:||..|  :::||.| |.:.|..|        .||||     .| 
plant   128 ------C-LVGGGEIPDETTLVCARGSDSALELLSTCKLANLTV--------KAELG-----CC- 171

  Fly   496 TGLELLEKSASVNLQGSKCSFENCALGILADGFV--LGEQRTEKVL 539
                ||.:|..:.:.|.....|...|..|:...|  .|::..|.:|
plant   172 ----LLHRSGRLTIDGCVLQCETNPLDHLSCPIVSTAGDEDIENIL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nesdNP_610025.1 None
SKIP5NP_001326222.1 F-box-like 43..80 CDD:403981 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14695
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.