DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf13 and TAF13

DIOPT Version :9

Sequence 1:NP_610024.1 Gene:Taf13 / 35297 FlyBaseID:FBgn0032847 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_005636.1 Gene:TAF13 / 6884 HGNCID:11546 Length:124 Species:Homo sapiens


Alignment Length:120 Identity:84/120 - (70%)
Similarity:95/120 - (79%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DDAEDDQFVATN-----------SGRKRLFSKELRCMMFGFGDDKNPYTETVDLLEDLVIEYIAE 73
            |:.||..|...|           ..|||||||||||||:|||||:|||||:||:|||||||:|.|
Human     3 DEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITE 67

  Fly    74 TTHRAMEIGRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKARKAFDEIKY 128
            .||:||.|||.||||||||:||:||||||:||||||||||||||:|||||||..|
Human    68 MTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf13NP_610024.1 TAF13 35..124 CDD:173962 74/88 (84%)
TAF13NP_005636.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 5/24 (21%)
TAF13 29..118 CDD:173962 74/88 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141564
Domainoid 1 1.000 161 1.000 Domainoid score I4026
eggNOG 1 0.900 - - E1_COG5248
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4126
Inparanoid 1 1.050 169 1.000 Inparanoid score I4144
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55939
OrthoDB 1 1.010 - - D1478135at2759
OrthoFinder 1 1.000 - - FOG0004905
OrthoInspector 1 1.000 - - oto88728
orthoMCL 1 0.900 - - OOG6_103773
Panther 1 1.100 - - LDO PTHR11380
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 1 1.000 - - X3459
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.