DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf13 and taf13

DIOPT Version :9

Sequence 1:NP_610024.1 Gene:Taf13 / 35297 FlyBaseID:FBgn0032847 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016066.1 Gene:taf13 / 548820 XenbaseID:XB-GENE-5785406 Length:124 Species:Xenopus tropicalis


Alignment Length:123 Identity:86/123 - (69%)
Similarity:100/123 - (81%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EGGDFNFDDDAEDDQFVATNSG------RKRLFSKELRCMMFGFGDDKNPYTETVDLLEDLVIEY 70
            |..|..|:|:.|:    |:.|.      |||||||||||||:|||||:|||||:||:|||||||:
 Frog     4 EDEDQTFEDETEE----ASGSAEGGQGRRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEF 64

  Fly    71 IAETTHRAMEIGRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKARKAFDEIKY 128
            |.|.||:||.|||.||||||||:||:||||||:||||||||||||||:|||||||..|
 Frog    65 ITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf13NP_610024.1 TAF13 35..124 CDD:173962 74/88 (84%)
taf13NP_001016066.1 TAF13 29..118 CDD:173962 74/88 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3986
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4126
Inparanoid 1 1.050 172 1.000 Inparanoid score I3979
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478135at2759
OrthoFinder 1 1.000 - - FOG0004905
OrthoInspector 1 1.000 - - oto102597
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 1 1.000 - - X3459
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.