DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf13 and taf13

DIOPT Version :9

Sequence 1:NP_610024.1 Gene:Taf13 / 35297 FlyBaseID:FBgn0032847 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001004665.1 Gene:taf13 / 324153 ZFINID:ZDB-GENE-030131-2873 Length:124 Species:Danio rerio


Alignment Length:126 Identity:89/126 - (70%)
Similarity:103/126 - (81%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MPEENFEGGDFNFDDDAEDDQFVATNSG---RKRLFSKELRCMMFGFGDDKNPYTETVDLLEDLV 67
            |.||..:.|   ||:|. ||.....:||   |||||||||||:|:|||||:|||||:||:|||||
Zfish     1 MVEEEDDPG---FDEDL-DDGGNGADSGQGRRKRLFSKELRCVMYGFGDDQNPYTESVDILEDLV 61

  Fly    68 IEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKARKAFDEIKY 128
            ||:|.|.||:||.|||.||||||||:||:||||||:|||||||||||||:||||||||..|
Zfish    62 IEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELEKARKAFDEANY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf13NP_610024.1 TAF13 35..124 CDD:173962 73/88 (83%)
taf13NP_001004665.1 TAF13 29..118 CDD:173962 73/88 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574543
Domainoid 1 1.000 162 1.000 Domainoid score I3960
eggNOG 1 0.900 - - E1_COG5248
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4126
Inparanoid 1 1.050 175 1.000 Inparanoid score I4053
OMA 1 1.010 - - QHG55939
OrthoDB 1 1.010 - - D1478135at2759
OrthoFinder 1 1.000 - - FOG0004905
OrthoInspector 1 1.000 - - oto40531
orthoMCL 1 0.900 - - OOG6_103773
Panther 1 1.100 - - LDO PTHR11380
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 1 1.000 - - X3459
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.