DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf13 and taf-13

DIOPT Version :9

Sequence 1:NP_610024.1 Gene:Taf13 / 35297 FlyBaseID:FBgn0032847 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_496289.2 Gene:taf-13 / 192052 WormBaseID:WBGene00006397 Length:121 Species:Caenorhabditis elegans


Alignment Length:111 Identity:55/111 - (49%)
Similarity:83/111 - (74%) Gaps:1/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDDDAEDDQFVATN-SGRKRLFSKELRCMMFGFGDDKNPYTETVDLLEDLVIEYIAETTHRAMEI 81
            |..|||||:....| ..:|.:..::||.|::||||||.||.:|:|.||.:|:.||.|....||::
 Worm     8 FGSDAEDDKEKVVNPEDKKHVLRRDLRSMVYGFGDDKEPYDKTLDTLEAIVLNYIKELCQLAMKV 72

  Fly    82 GRTGRVQVEDIIFLVRKDPRKYARVKDLLTMNEELKKARKAFDEIK 127
            |:..::.:|||.:|:|:||:|::||||||:|:||||||||.|:::|
 Worm    73 GKPDKMALEDIHYLIRRDPKKFSRVKDLLSMSEELKKARKQFEDMK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf13NP_610024.1 TAF13 35..124 CDD:173962 46/88 (52%)
taf-13NP_496289.2 TFIID-18kDa 27..116 CDD:190265 46/88 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156551
Domainoid 1 1.000 106 1.000 Domainoid score I4145
eggNOG 1 0.900 - - E1_COG5248
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4126
Inparanoid 1 1.050 119 1.000 Inparanoid score I3353
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55939
OrthoDB 1 1.010 - - D1478135at2759
OrthoFinder 1 1.000 - - FOG0004905
OrthoInspector 1 1.000 - - oto17268
orthoMCL 1 0.900 - - OOG6_103773
Panther 1 1.100 - - LDO PTHR11380
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2300
SonicParanoid 1 1.000 - - X3459
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.