DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and AIF1

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_014472.1 Gene:AIF1 / 855811 SGDID:S000005357 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:443 Identity:97/443 - (21%)
Similarity:148/443 - (33%) Gaps:150/443 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVGGGIAGVSCAESLAIYRP---NASILLLTESSIVKSVTNLV--PVARYLHKFDVREQDVSEM 67
            :|||.|:.|||.|..|  ||.   ..:|.|:|.|:.|..:.:.|  .|::...|..:..::|.:.
Yeast     9 VVVGAGVFGVSVANHL--YRELGGTYAIKLVTASNYVYFLPSAVRLTVSKDYTKSILPLKNVLDS 71

  Fly    68 GASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPL----VIGIRDTD 128
            |  .:.:.|.....:.:|..:.:...  ||:..|.|.||       .|..:|:    ..|....:
Yeast    72 G--IEVIKDTAASFDDKEVVLGSDRA--IKFDILVLATG-------SKWADPIGSTYTFGDNYKE 125

  Fly   129 SVQLLQRKLATAKDVLILGNGGIASELAYEL------------KDVNVHWVVKDSHISATFV-DP 180
            ..:....:::.|..:|.||.|.:..|||.||            |.:::      .|.|...: |.
Yeast   126 YFEREASRISDADHILFLGGGFVNCELAGELLFKYLEEIRSGKKRISI------IHNSDKLLPDS 184

  Fly   181 GAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQT------------NNHGAALGPDWHRSV 233
            |.                          |::.|.|..|            |..||        |:
Yeast   185 GL--------------------------YNDTLRKNVTDYLSKNGITLYLNTVGA--------SL 215

  Fly   234 DLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDY 298
            |.|          ||..:..                     :||.:.:..|.|....|:.||...
Yeast   216 DTS----------PKRIFLG---------------------EGSSKYIDADLIYRGVGISPNVPV 249

  Fly   299 T-----CDSPLQFSDDGGISVDEMMRTNLVD---VFAAGDVCTANWPAAMHWFQMR-LWTQARQM 354
            .     ||.      .|.|.|::..|...|:   |||.|||....:    |....| .|......
Yeast   250 NSISDLCDK------KGFIQVEKNFRVKAVEAGNVFAIGDVTNFRY----HGLVKRDNWVDVLTR 304

  Fly   355 GSMAGRSMAAASEGESVYQDFCFELFGHV--------TKLFG-YPVVLLGRFN 398
            ..::  |:...:|...|..| |.|. ||.        ...|| :|:.|||..|
Yeast   305 NVIS--SLQEGTEASLVDAD-CLET-GHAPSGVSLGPNAGFGQFPLPLLGTIN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 82/389 (21%)
AIF1NP_014472.1 Pyr_redox_2 21..>293 CDD:423044 73/365 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.