DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and TRR1

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_010640.1 Gene:TRR1 / 851955 SGDID:S000002761 Length:319 Species:Saccharomyces cerevisiae


Alignment Length:405 Identity:87/405 - (21%)
Similarity:125/405 - (30%) Gaps:144/405 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVGGGIAGVSCAESLAIYRPNASIL-LLTESSIVKSV------TNLVPVARYLHKFDVREQDVSE 66
            ::|.|.|    |.:.|||...|.|. :|.|..:...:      |....:..:....|        
Yeast     8 IIGSGPA----AHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPD-------- 60

  Fly    67 MGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDS-V 130
             |.:...|:||:     ||.  .||.|.||                           |.:|.| |
Yeast    61 -GLTGSELMDRM-----REQ--STKFGTEI---------------------------ITETVSKV 90

  Fly   131 QLLQR--KLAT---------AKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAE 184
            .|..:  ||.|         ..|.:||..|..|..:  .|.....:|   ...|||..|..||..
Yeast    91 DLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRM--HLPGEETYW---QKGISACAVCDGAVP 150

  Fly   185 FFH---IAM-----NECN-----AKDSSPVVAIKR---MRYSEVLPKEQTNNHGAALGPDWHRSV 233
            .|.   :|:     :.|.     .|..|.|..:.|   :|.|.::.|....|....:   .:.:|
Yeast   151 IFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEI---LYNTV 212

  Fly   234 DLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDY 298
            .|....:|      |:....||.:.:          |.|..|     |....:..|.|..|.|..
Yeast   213 ALEAKGDG------KLLNALRIKNTK----------KNEETD-----LPVSGLFYAIGHTPATKI 256

  Fly   299 TCDSPLQFSDDGGISVDE---------MMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQM 354
            ..         |.:..||         ...|::...||||||..:.:               ||.
Yeast   257 VA---------GQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKY---------------RQA 297

  Fly   355 GSMAGRSMAAASEGE 369
            .:.||....||.:.|
Yeast   298 ITSAGSGCMAALDAE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 82/389 (21%)
TRR1NP_010640.1 TRX_reduct 5..315 CDD:273540 87/405 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.