DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and AIFM2

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001185625.1 Gene:AIFM2 / 84883 HGNCID:21411 Length:373 Species:Homo sapiens


Alignment Length:451 Identity:85/451 - (18%)
Similarity:165/451 - (36%) Gaps:148/451 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVRE---QDVSEMGA 69
            ::||||..|::.|..|...  |...:|:                      |:::   .:|:.:.|
Human    15 VIVGGGFGGIAAASQLQAL--NVPFMLV----------------------DMKDSFHHNVAALRA 55

  Fly    70 SFQT----------LVDRLDH--------INSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKV 116
            |.:|          .|...|:        |:.:...:..:.|..:.:.:|.|.||.|.. |.||.
Human    56 SVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGP-FPGKF 119

  Fly   117 --VNPLVIGIRD-TDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFV 178
              |:.....|:. .|.|:.:||    ::.::::|.|....|:|.|:|.......|...|......
Human   120 NEVSSQQAAIQAYEDMVRQVQR----SRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA 180

  Fly   179 DPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEE 243
            |                |:..|.|   |....|:|                        .|:|.:
Human   181 D----------------KELLPSV---RQEVKEIL------------------------LRKGVQ 202

  Fly   244 NRLPKIYYKSRISSVQDL-ADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTD-YTCDSPLQF 306
                 :....|:|::::| .::....:|::.:.|:  ::..:.::..||:..|:. |......:.
Human   203 -----LLLSERVSNLEELPLNEYREYIKVQTDKGT--EVATNLVILCTGIKINSSAYRKAFESRL 260

  Fly   307 SDDGGISVDEMMRT-NLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAG--RSMAAASEG 368
            :..|.:.|:|.::. ...:|:|.||......|               :|..:||  .::|.|:..
Human   261 ASSGALRVNEHLQVEGHSNVYAIGDCADVRTP---------------KMAYLAGLHANIAVANIV 310

  Fly   369 ESVYQDFCFELFGHVTKLFGY-PVVL-----------LGRFNGQDLGRDYEILVRCTRNKE 417
            .||.|          ..|..| |..|           :|:.:|..:||   ::||.|::::
Human   311 NSVKQ----------RPLQAYKPGALTFLLSMGRNDGVGQISGFYVGR---LMVRLTKSRD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 66/373 (18%)
AIFM2NP_001185625.1 NirB 39..356 CDD:330997 77/421 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.