DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and AT5G22140

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_680200.1 Gene:AT5G22140 / 832275 AraportID:AT5G22140 Length:365 Species:Arabidopsis thaliana


Alignment Length:339 Identity:81/339 - (23%)
Similarity:128/339 - (37%) Gaps:95/339 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVGGGIAGVSCAESLAIYRPNASILLLTESSIVK----SVTNLVPVARYLHKFDVREQDVSEMG 68
            :|:||||||...|:.|..   :|.:.|:......:    |:.::|. .::..:..:..:...:.|
plant    15 VVIGGGIAGSLAAKLLQF---DAEVTLIDPKEYFEITWASLRSMVE-PKFAERTVINHKSYLKQG 75

  Fly    69 ASFQTLVDRL---DHINSREHCIRTKAGLEIKYRYLCLCTGGT---PKLFSGKVVNPLVIGIRDT 127
                    ||   ..||..|..:.|:.|..|.|.||.:.||..   ||....|:           
plant    76 --------RLVTSPAINITESDVMTEDGSVIGYDYLVIATGHNDLFPKTRQEKL----------- 121

  Fly   128 DSVQLLQRKLATAKDVLILGNG----GIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHI 188
            ...|....|:.::..|||:|.|    .:|:|:|.:..:..|..|.|         .|...||   
plant   122 SHYQSEYEKIKSSGSVLIVGGGPSGVELAAEIAVDFPEKKVTLVHK---------GPRLLEF--- 174

  Fly   189 AMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKS 253
             :.:..|..:|..:..|::   ||:               .::|||||.|.:|.     |||..|
plant   175 -VGQKAADKASDWLESKKV---EVI---------------LNQSVDLSSASDGN-----KIYRTS 215

  Fly   254 RISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDEMM 318
            ...::              |.|..|  |.....:|:.  |.|.....||   ....|.:.|||.:
plant   216 GGETI--------------HADIHF--LCVGKPLSSQ--WLNGTVLKDS---LDGKGRVMVDEYL 259

  Fly   319 R-TNLVDVFAAGDV 331
            | ....:|||.||:
plant   260 RIRGRSNVFAVGDI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 81/339 (24%)
AT5G22140NP_680200.1 Ndh 10..346 CDD:224172 81/339 (24%)
NAD_binding_7 10..>47 CDD:289982 11/34 (32%)
Methyltrn_RNA_3 <88..152 CDD:299893 19/74 (26%)
Pyr_redox 136..>200 CDD:278498 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.