DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and NDC1

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_568205.6 Gene:NDC1 / 830775 AraportID:AT5G08740 Length:519 Species:Arabidopsis thaliana


Alignment Length:375 Identity:81/375 - (21%)
Similarity:129/375 - (34%) Gaps:107/375 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKCEFLVVGGGIAGVSCA---ESLA---IYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVRE 61
            |.|   ::|||..|:..|   |||.   ..:|...::..:|..:.|.:         |::....|
plant    82 RVC---ILGGGFGGLYTALRLESLVWPEDKKPQVVLVDQSERFVFKPM---------LYELLSGE 134

  Fly    62 QDVSEMGASF---------QTLVDRL------DH--INSRE-----HCIRTKAGLEIKYRYLCLC 104
            .||.|:...|         |.|.||:      ||  :|..|     ..:..::|.:|:|.:|.|.
plant   135 VDVWEIAPRFSDLLTNTGIQFLRDRVKTLLPCDHLGVNGSEISVTGGTVLLESGFKIEYDWLVLA 199

  Fly   105 TGGTPKLFSGKVV----------NPLVIGIRDTDSVQLLQRKL---ATAKDVLILGNGGIASELA 156
            .|...||   .||          ..|...||..:.:..|:||.   .:|..|.::|.|....|||
plant   200 LGAESKL---DVVPGAMELAFPFYTLEDAIRVNEKLSKLERKNFKDGSAIKVAVVGCGYAGVELA 261

  Fly   157 YELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNH 221
                          :.||....|.|..:..:::.|                    :|......|.
plant   262 --------------ATISERLQDRGIVQSINVSKN--------------------ILTSAPDGNR 292

  Fly   222 GAALGPDWHRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSF--QQLTCD 284
            .||:.....|.|.|...           |....|....:|.:|.|..::|:..:...  |.:..|
plant   293 EAAMKVLTSRKVQLLLG-----------YLVQSIKRASNLEEDEGYFLELQPAERGLESQIIEAD 346

  Fly   285 FIVSATGVWP---NTDYTCDSPLQFSDDGGISVDEMMRT-NLVDVFAAGD 330
            .::...|..|   ..:.:..:.|..:..|....||.:|. ....:||.||
plant   347 IVLWTVGAKPLLTKLEPSGPNVLPLNARGQAETDETLRVKGHPRIFALGD 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 79/370 (21%)
NDC1NP_568205.6 Ndh 80..499 CDD:224172 81/375 (22%)
NADB_Rossmann 247..316 CDD:304358 19/113 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1463391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.