DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and Sqor

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001041378.2 Gene:Sqor / 691966 RGDID:1564504 Length:450 Species:Rattus norvegicus


Alignment Length:451 Identity:96/451 - (21%)
Similarity:174/451 - (38%) Gaps:88/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFLVVGGGIAGVSC---------AESLAIYRPNASILLLTESSIVKSVTNLVPV-ARYLHKFDVR 60
            |.||:|||..|::.         ||::||..|       :|....:.:..||.. |:.|...|  
  Rat    45 EVLVLGGGSGGITMATRMKRRVGAENVAIVEP-------SERHFYQPIWTLVGAGAKELSSSD-- 100

  Fly    61 EQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIR 125
            ...:|.:.:..|.:.||:..:|..::||||..|.||.||||.                 :.:||:
  Rat   101 RSTLSVIPSGVQWIQDRVAELNPDQNCIRTDNGKEISYRYLI-----------------IALGIQ 148

  Fly   126 -DTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW-VVKDSHISATFVDPGAAEFFHI 188
             |.:.::.|....|..|    :|:.       |.:|.|...| .::|      |.:..|...|..
  Rat   149 LDYEKIKGLPEGFAYPK----IGSN-------YSVKTVEKTWKALQD------FKEGNALFTFPN 196

  Fly   189 AMNECNAKDSSPVVAIKRMRYSEVLPKEQTN-NHGAALGPDWHRSVDLSGAREGEENRLPKIYYK 252
            ...:| |.....::.:....:.:...:.:.| ....|||..:.........:|....|...:.||
  Rat   197 TPVKC-AGAPQKIMYLSEAYFRKTGKRSKANIIFNTALGTIFGVKKYADALQEIIRERNVSVNYK 260

  Fly   253 SRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGG-ISVDE 316
            ..:..|:  ||...|:.:...:.|....:..: ::..|....:.|....||:  :|..| :.||:
  Rat   261 HNLIEVR--ADKQEAVFENLDKPGETHVIHYE-MLHVTPPMSSPDVLKRSPV--ADSAGWVDVDK 320

  Fly   317 --MMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAG---RSMAAASEGESVYQDFC 376
              :......:||..|| || |.|.:         ..|..:.:.:|   |:::...:.::..:.  
  Rat   321 ETLQHKKYPNVFGIGD-CT-NLPTS---------KTAAAVAAQSGILDRTISLIMKNQTPTKK-- 372

  Fly   377 FELFGHVTKLFGYPVVLLGRFN--GQDL-----GRDYEILVRCTRNKEYIKFVLQNGRLRG 430
            ::.:.....:.||..|:|..|:  .|.|     .:..|.:.......:.:.|:..|..|||
  Rat   373 YDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERISMYLMKADMMPFLYWNMMLRG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 80/362 (22%)
SqorNP_001041378.2 FadH2 46..425 CDD:223523 90/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.