DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and SQOR

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001258142.1 Gene:SQOR / 58472 HGNCID:20390 Length:450 Species:Homo sapiens


Alignment Length:462 Identity:93/462 - (20%)
Similarity:169/462 - (36%) Gaps:110/462 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFLVVGGGIAGVSC---------AESLAIYRPNASILLLTESSIVKSVTNLVPV-ARYLHKFDVR 60
            |.||:|||..|::.         ||::||..|       :|....:.:..||.. |:.|......
Human    45 EVLVLGGGSGGITMAARMKRKVGAENVAIVEP-------SERHFYQPIWTLVGAGAKQLSSSGRP 102

  Fly    61 EQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIR 125
            ...|...|..:  :..|:..:|..::||.|....:|.||||.                 :.:||:
Human   103 TASVIPSGVEW--IKARVTELNPDKNCIHTDDDEKISYRYLI-----------------IALGIQ 148

  Fly   126 -DTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW-VVKDSHISATFVDPGAAEFFHI 188
             |.:.::.|....|..|    :|:.       |.:|.|...| .::|      |.:..|...|..
Human   149 LDYEKIKGLPEGFAHPK----IGSN-------YSVKTVEKTWKALQD------FKEGNAIFTFPN 196

  Fly   189 AMNECNAKDSSPVVAIKRMRYSEVLPKEQTN-----NHGAALGPDWHRSVDLSGAREGEENRLPK 248
            ...:| |.....::.:....:.:...:.:.|     :.||..|...:    ....:|..:.|...
Human   197 TPVKC-AGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKY----ADALQEIIQERNLT 256

  Fly   249 IYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGG-I 312
            :.||..:..|:  ||...|:.:...:.|..|.::.:.:.....:.| .|....||:  :|..| :
Human   257 VNYKKNLIEVR--ADKQEAVFENLDKPGETQVISYEMLHVTPPMSP-PDVLKTSPV--ADAAGWV 316

  Fly   313 SVDE--MMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAG---RSMAAASEGESVY 372
            .||:  :......:||..|| || |.|.:         ..|..:.:.:|   |:::...:.::..
Human   317 DVDKETLQHRRYPNVFGIGD-CT-NLPTS---------KTAAAVAAQSGILDRTISVIMKNQTPT 370

  Fly   373 QDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDY--------------EILVRCTRNKEYIKFVL 423
            :.  ::.:.....:.||..|:|..|       ||              |.|.......:.:.|:.
Human   371 KK--YDGYTSCPLVTGYNRVILAEF-------DYKAEPLETFPFDQSKERLSMYLMKADLMPFLY 426

  Fly   424 QNGRLRG 430
            .|..|||
Human   427 WNMMLRG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 76/366 (21%)
SQORNP_001258142.1 FadH2 56..398 CDD:223523 79/414 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.