DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and Trxr-2

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_524216.1 Gene:Trxr-2 / 40475 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster


Alignment Length:446 Identity:80/446 - (17%)
Similarity:147/446 - (32%) Gaps:158/446 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFLVVGGGIAGVSCAESLA----------IYRP--------------NASIL---------LLTE 37
            :.:|:|||.||::||:..|          ..:|              |...:         ||.|
  Fly    34 DLVVLGGGSAGLACAKEAAGCGARVLCFDYVKPTPVGTKWGIGGTCVNVGCIPKKLMHQASLLGE 98

  Fly    38 S---------------------SIVKSVTNLVPVARYLHKFDVREQDVSEMGASFQTLVDRLDHI 81
            :                     .:|:||.|.:....::.:.|:|::              :::::
  Fly    99 AVHEAVAYGWNVDDTNIRPDWRKLVRSVQNHIKSVNWVTRVDLRDK--------------KVEYV 149

  Fly    82 NSR-----EHCIRTKA--GLE---IKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQLLQRK 136
            ||.     .|.|...|  |.|   :...|:.:..||.|:.  ..:...:.:|| .:|.:...:|:
  Fly   150 NSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRY--PDIPGAVELGI-TSDDIFSYERE 211

  Fly   137 LATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPV 201
            ...   .|::|.|.:..|.|..||.:..                                  .|.
  Fly   212 PGR---TLVVGAGYVGLECACFLKGLGY----------------------------------EPT 239

  Fly   202 VAIKRM-------RYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKSRISSVQ 259
            |.::.:       :.||:|....|......||....::|:    |:.:...|  :.|::..:.: 
  Fly   240 VMVRSIVLRGFDRQMSELLAAMMTERGIPFLGTTIPKAVE----RQADGRLL--VRYRNTTTQM- 297

  Fly   260 DLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDEMMRTNLVD 324
            |.:|....::......|..:.|..|    |.||             .:.|..|.||....|::..
  Fly   298 DGSDVFDTVLWAIGRKGLIEDLNLD----AAGV-------------KTHDDKIVVDAAEATSVPH 345

  Fly   325 VFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSMAAASEGESVYQDFCFELF 380
            :||.||:.         :.:..|...|...|.:..|.:.|.|.....|.|....:|
  Fly   346 IFAVGDII---------YGRPELTPVAILSGRLLARRLFAGSTQLMDYADVATTVF 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 73/417 (18%)
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358 10/33 (30%)
TGR 31..515 CDD:273624 80/446 (18%)
NADB_Rossmann <144..239 CDD:304358 22/148 (15%)
Pyr_redox 214..288 CDD:278498 18/116 (16%)
Pyr_redox_dim 388..497 CDD:280934 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.