DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and CG7430

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001262000.1 Gene:CG7430 / 39988 FlyBaseID:FBgn0036762 Length:504 Species:Drosophila melanogaster


Alignment Length:336 Identity:64/336 - (19%)
Similarity:122/336 - (36%) Gaps:112/336 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GVSCAE-SLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGASFQTLVDRLD 79
            |:||.. ||.:.:     |:..:|:.||::|..:.:.       .::..|::: ..|.|:|    
  Fly   106 GISCGSVSLDLEK-----LMGQKSNAVKALTGGIAML-------FKKNKVTQL-TGFGTIV---- 153

  Fly    80 HINSREHCIRTKAGL--EIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQLLQRKLATAKD 142
              |..|..::...|.  .:|.:.:.:.||.....|.|..::..|| :..|.:::|.:    ..|.
  Fly   154 --NPNEVEVKKSDGSTETVKTKNILIATGSEVTPFPGIEIDEEVI-VSSTGALKLAK----VPKH 211

  Fly   143 VLILGNGGIASEL------------AYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNA 195
            ::::|.|.|..||            |.|..| .:..|..|:.:|.||                  
  Fly   212 LVVIGAGVIGLELGSVWSRLGAEVTAIEFMD-TIGGVGIDNEVSKTF------------------ 257

  Fly   196 KDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKSRISSVQD 260
                          .:||.|:         |..:.....::.|....:|                
  Fly   258 --------------QKVLTKQ---------GLKFKLGTKVTAASRSGDN---------------- 283

  Fly   261 LADDAGAIVKLEH-EDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQF-----SDDGGISVDEMMR 319
                  ..|.:|: :.|..:::.||.::.:.|..|   ||....|:.     .|.|.|.|:...:
  Fly   284 ------VTVSVENAKSGEKEEIQCDALLVSVGRRP---YTEGLGLEAVGIVKDDRGRIPVNATFQ 339

  Fly   320 TNLVDVFAAGD 330
            |.:.:::|.||
  Fly   340 TVVPNIYAIGD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 64/336 (19%)
CG7430NP_001262000.1 PRK06327 35..504 CDD:235779 64/336 (19%)
NADB_Rossmann 35..>74 CDD:304358
Pyr_redox 211..290 CDD:278498 20/142 (14%)
Pyr_redox_dim 385..491 CDD:280934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464305
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.