DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and CG14997

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster


Alignment Length:500 Identity:97/500 - (19%)
Similarity:171/500 - (34%) Gaps:157/500 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKCEFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHK--FDVREQDVS 65
            ::|:.||||||..|.:.|..|       |..|.::..:|     |.|..::.::  |.:....:.
  Fly    42 QECQVLVVGGGTGGCAMAAKL-------SSRLGSDKVVV-----LEPEDKHYYQPMFTLIGGGMK 94

  Fly    66 EMGASFQTLVDRLD-----------HINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNP 119
            .:..|.:.:.|.|.           ..:...:.:.|..|..|||.:|.:.||  .:|..||:  |
  Fly    95 RLDQSHRQMADVLPTKAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATG--LQLNYGKI--P 155

  Fly   120 LVIGIRDT--------------DSVQLLQRKLATAKDVLILGN-----GGIASELAYELKDVNVH 165
            .::...:|              |.|....|:......:....|     .|...::||    ::.|
  Fly   156 GLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQKIAY----ISEH 216

  Fly   166 WVVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVV-AIKRMRYSEVLPKEQTNNHGAALGPDW 229
            :          |...|..:..:|..|     .|.||: .:|  .|:|.|.|...           
  Fly   217 Y----------FRKMGRRDNVNIIYN-----TSLPVIFGVK--HYAEALMKLIK----------- 253

  Fly   230 HRSVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQL------------- 281
            .|::.|:..|     .|.::.:|..|:..:|||...      .|.:.::..|             
  Fly   254 RRNITLNVQR-----NLVEVRHKDNIAVFEDLAKPG------VHYEETYSMLHVTPPMSTPDVVA 307

  Fly   282 TCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDE--MMRTNLVDVFAAGDVCTANWPAAMHWFQ 344
            .|..:|:.||.                   :.||:  :......:|||.||  :|:.|      .
  Fly   308 NCKKLVTPTGF-------------------VDVDQLTLQHNKYSNVFAIGD--SASSP------N 345

  Fly   345 MRLWTQARQMGSMAGRSMAAASEGES---VYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDY 406
            .:....|.....:..:::.||.||::   :|..     :.....:.||...:|..|       ||
  Fly   346 SKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDG-----YSSCPIVTGYSSCILAEF-------DY 398

  Fly   407 EILVRCTRNKEYIKFVLQNGRLRGAMLIGNTDLAETCE-NLILNG 450
            .:....|       |.|...:.|.:|.....:|..... .|::||
  Fly   399 NLTPVET-------FPLDQSKERYSMFFMKKELMPVLYWKLMMNG 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 76/394 (19%)
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 66/362 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.