DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and CG10700

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_609942.1 Gene:CG10700 / 35183 FlyBaseID:FBgn0032754 Length:539 Species:Drosophila melanogaster


Alignment Length:431 Identity:94/431 - (21%)
Similarity:170/431 - (39%) Gaps:95/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLT-ESSIVKSVTNLVPVAR-YLHKFDVR-EQDVSEMG 68
            |:|||||.:|..|.|:|........:.|:. |..:....|.::.:.. |.....:| ||...:.|
  Fly   134 FVVVGGGPSGAVCVETLRQEGFTGRLTLVCGEKHLPYDRTRIMNLLNTYTKNLALREEQFYKDYG 198

  Fly    69 ASFQTLV--DRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQ 131
            ...|..|  :|||...:..||..   |....|..:.:.||.:       .|.|.:.|:.      
  Fly   199 IEMQLGVSAERLDTNCNTLHCTN---GKTFPYDKIYIATGYS-------AVTPNIPGVH------ 247

  Fly   132 LLQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAK 196
                    .|:|.::.|.|.|..: :::.|.:...|...|...|.          ....|..:..
  Fly   248 --------LKNVKVIRNIGDARSI-FKMVDKSTQVVCLGSSFMAV----------EATANLVSRA 293

  Fly   197 DSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPKIYYKSRISS--VQ 259
            .|..:||.:.:.:...|        |..:|   .|.:.|.     |||::     ..|:||  ::
  Fly   294 RSVTLVARQNVPFKSTL--------GELIG---QRILKLL-----EENKV-----DLRMSSGIIR 337

  Fly   260 DLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNTDYTCDSPLQFSDDGGISVDEMMRTNLVD 324
            .|.:..|.:|.::..|.|  ::.|:.::..||...|||:...|.:..:.:|.:.|::.::|.:.:
  Fly   338 ILGNSRGEVVAVKLLDNS--RIPCNLLILGTGCQCNTDFLQRSGININPNGSVDVNDFLQTKVRN 400

  Fly   325 VFAAGDVCTA----NWPAAMHWFQMRLWTQARQMGSMAGRSMAAASEGESVYQDFCFELFGHVTK 385
            |:..||:..|    .:|..::.....|   |:..|.:|..:|:                 ||:.|
  Fly   401 VYVGGDIANAYILGGFPDRVNISHYGL---AQYHGRIAALNMS-----------------GHIAK 445

  Fly   386 LFGYP---VVLLGR-FNGQDLGRDYEILVRCTRNKEYIKFV 422
            |...|   .|:.|| |.....|...::::  ..:.|.::||
  Fly   446 LEAIPFFYTVIFGRAFRSAGYGPFKDVVI--DGSLEDLQFV 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 77/357 (22%)
CG10700NP_609942.1 Rieske_AIFL_N 10..106 CDD:239560
Pyr_redox_2 135..414 CDD:285266 74/336 (22%)
Pyr_redox 273..350 CDD:278498 21/107 (20%)
COG3393 336..>508 CDD:225928 38/173 (22%)
Reductase_C 464..527 CDD:291425 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464304
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.