DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and AIF

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_722765.2 Gene:AIF / 33390 FlyBaseID:FBgn0031392 Length:739 Species:Drosophila melanogaster


Alignment Length:406 Identity:85/406 - (20%)
Similarity:140/406 - (34%) Gaps:107/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVVGGGIAGVSCAESLAIYRPNASILLLTES--------SIVKSV-----TNLVPVARYLHK-- 56
            :|::|||.|..|...::......|.:|:::..        .:.|.:     .|..|:..|..|  
  Fly   257 YLIIGGGTAAFSAFRAIKSNDATAKVLMISNEFRKPYMRPPLSKELWYTPNPNEDPIKDYRFKQW 321

  Fly    57 ---------------FDVREQDVSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTG 106
                           .|..:.|.:..|.........:..:::::..:....|.||.|....:.||
  Fly   322 TGSERSLFFEPDEFFIDPEDLDDNANGGIAVAQGFSVKKVDAQKRIVTLNDGYEISYDECLIATG 386

  Fly   107 GTPKLF-----SGKVVNPLVIGIRDTDSVQLLQRKLATAKDVLILGNGGIASELAYELKDVNVHW 166
            ..||..     :...|...|:..|..|....|::..|..:.:.|:|||.|.||||..|       
  Fly   387 CAPKNLPMLRDAPPSVLEKVMVYRTPDDFDRLRKLAAEKRSITIVGNGFIGSELACSL------- 444

  Fly   167 VVKDSHISATFVDPGAAEFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHR 231
                :|.|.   :....:.:.:.....|              .|:|||...:.         |..
  Fly   445 ----AHYSR---ENNGGKVYQVFQENAN--------------MSKVLPNYLSR---------WTT 479

  Fly   232 SVDLSGAREGEENRLPKIYYKSRISSVQDLADDAGAIVKLEHEDGSFQQLTCDFIVSATGVWPNT 296
            :       :.|...:..|...|..|:|:|..:     :|||..:|  ..|..|.:|...|..|||
  Fly   480 A-------KMEAQGVCVIPNASIRSAVRDETN-----LKLELNNG--MTLMSDVVVVCVGCTPNT 530

  Fly   297 DYTCDSPLQFSDD-GGISVDEMM--RTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQ----- 353
            |....|.|:.... ||..|:..:  |.||   :.|||        |..:|...|..:..:     
  Fly   531 DLAGPSRLEVDRSLGGFVVNAELEARRNL---YVAGD--------ASCFFDPLLGRRRVEHHDHS 584

  Fly   354 --MGSMAGRSMAAASE 367
              .|.:||.:|..|.:
  Fly   585 VVSGRLAGENMTGAKK 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 80/391 (20%)
AIFNP_722765.2 Pyr_redox_2 257..573 CDD:285266 79/377 (21%)
Pyr_redox 427..512 CDD:278498 27/133 (20%)
AIF_C 591..720 CDD:291391 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.