DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and CG4199

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster


Alignment Length:456 Identity:91/456 - (19%)
Similarity:156/456 - (34%) Gaps:145/456 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVVGGGIAGVSCAESL--------AIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQD 63
            |:|||||.:|....|::        .|:......|......|.|::...:...|:..:...:|.|
  Fly   182 FIVVGGGPSGAVAVETIRQEGFTGRLIFVCREDYLPYDRVKISKAMNLEIEQLRFRDEEFYKEYD 246

  Fly    64 VSEMGASFQTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTD 128
            : |:...  ...::||......||   ..|..:||..:.|.||.:       ...|.:.|: :.:
  Fly   247 I-ELWQG--VAAEKLDTAQKELHC---SNGYVVKYDKIYLATGCS-------AFRPPIPGV-NLE 297

  Fly   129 SVQLLQRKLATAKDVL----------ILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAA 183
            :|:.: |:||..|.:|          .||:..||.|.|..|       |.|...::..       
  Fly   298 NVRTV-RELADTKAILASITPESRVVCLGSSFIALEAAAGL-------VSKVQSVTVV------- 347

  Fly   184 EFFHIAMNECNAKDSSPVVAIKRMRYSEVLPKEQTNNHGAALGPDWHRSVDLSGAREGEENRLPK 248
                       .:::.|:.|.                .||.:|                      
  Fly   348 -----------GRENVPLKAA----------------FGAEIG---------------------- 363

  Fly   249 IYYKSRISSVQDLADDAGAIVKLE--------HEDGSFQQ--------LTCDFIVSATGVWPNTD 297
                   ..|..|.:|...::::|        :|||...:        |.||.::..||...||.
  Fly   364 -------QRVLQLFEDNKVVMRMESGIAEIVGNEDGKVSEVVLVDDTRLPCDLLILGTGSKLNTQ 421

  Fly   298 YTCDSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSM 362
            :...|.::.:.:|.:.|.:.:.:|:.||:..||:..|:.....|   .|:.....|:....||..
  Fly   422 FLAKSGVKVNRNGSVDVTDFLESNVPDVYVGGDIANAHIHGLAH---DRVNIGHYQLAQYHGRVA 483

  Fly   363 AAASEGESVYQDFCFELFGHVTKLFGYP---VVLLG---RFNGQDLGRDYEILVRCTRNKEYIKF 421
            |             ..:.|.|.||...|   .::.|   |:.|....:|    |....:.|..||
  Fly   484 A-------------INMCGGVKKLEAVPFFFTLIFGKGIRYAGHGSYKD----VIIDGSMEDFKF 531

  Fly   422 V 422
            |
  Fly   532 V 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 73/380 (19%)
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 70/366 (19%)
Pyr_redox 320..402 CDD:278498 21/151 (14%)
Reductase_C 505..577 CDD:291425 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.