DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pyroxd1 and pyroxd1

DIOPT Version :9

Sequence 1:NP_001260619.1 Gene:Pyroxd1 / 35296 FlyBaseID:FBgn0032846 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001120558.1 Gene:pyroxd1 / 100145712 XenbaseID:XB-GENE-5873721 Length:494 Species:Xenopus tropicalis


Alignment Length:500 Identity:211/500 - (42%)
Similarity:302/500 - (60%) Gaps:51/500 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFLVVGGGIAGVSCAESLAIYRPNASILLLTESSIVKSVTNLVPVARYLHKFDVREQDVSEMGAS 70
            :|:|||||||||:|||.||...|:..:.|||.|.::|:.|||..|:|.|..|||.||:.:.:...
 Frog    13 KFVVVGGGIAGVTCAEELAAQFPSDRVYLLTASPLIKATTNLKQVSRTLEAFDVEEQEGTALEGR 77

  Fly    71 F---QTLVDRLDHINSREHCIRTKAGLEIKYRYLCLCTGGTPKLFSGKVVNPLVIGIRDTDSVQL 132
            :   ..:...:..:.|:|..:.|:.|...:|..||||.|...|:.:|.  ||.|:|||||||.:.
 Frog    78 YPNISVVQSAVRELRSQEQEVVTEDGARYRYNKLCLCAGAKAKIIAGG--NPYVLGIRDTDSARE 140

  Fly   133 LQRKLATAKDVLILGNGGIASELAYELKDVNVHWVVKDSHISATFVDPGAAEFFHIAMNECNAKD 197
            .||.|::|:.|:|:||||||.||.|||:.....|.::|..|..||.|.|||:|.   :.:..|..
 Frog   141 FQRHLSSARRVVIVGNGGIALELVYELEGCQAIWAIRDGAIGNTFFDAGAAQFL---LPQLGADK 202

  Fly   198 SSPVVAIKRMRYSEVLPKEQTNNH-GAALGPDWHRSVDL--SGAREGEENRLPKIYYKSRISSVQ 259
            ....:..:|.:|:...|....... |:|||||||..::|  :||            :..|: .::
 Frog   203 PPAPLPCRRTKYTTEPPLGGGGGSVGSALGPDWHEGLNLKATGA------------FSHRV-HIE 254

  Fly   260 DLADDAGAIVKLEHE-------------DGS-------FQQLT------CDFIVSATGVWPNTD- 297
            ...:....:::.|.|             |.:       :.|||      ||||||||||.||.: 
 Frog   255 AQCEVRRILLREEREGLNITALPFPGESDSAPSTDWPVYVQLTNGKTYGCDFIVSATGVVPNIEP 319

  Fly   298 YTCDSPLQFSDDGGISVDEMMRTNLVDVFAAGDVCTANWPAAMHWFQMRLWTQARQMGSMAGRSM 362
            :...:....::|||:.|::.|.|::.:::||||:|||:|..:..|.||||||||||||..||:.|
 Frog   320 FVTGNQFDVAEDGGLRVNDHMETSVRNIYAAGDICTASWEPSALWQQMRLWTQARQMGWYAGKCM 384

  Fly   363 AAASEGESVYQDFCFELFGHVTKLFGYPVVLLGRFNGQDLGRDYEILVRCTRNKEYIKFVLQNGR 427
            ||....:.:..|||||||.||||.|.|.|:|||::|.|.||.|:|:|:|||:.:||:|.||:.||
 Frog   385 AADFLQQPIEMDFCFELFAHVTKFFNYKVILLGKYNAQGLGSDHELLLRCTKGREYVKAVLRGGR 449

  Fly   428 LRGAMLIGNTDLAETCENLILNGIDLEPYGDDILNPDIDIEDYFD 472
            :.||:|||:|||.||.|||:||.:||.|||:.:|:||:|||||||
 Frog   450 MVGAVLIGDTDLEETFENLMLNQMDLSPYGERLLDPDVDIEDYFD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pyroxd1NP_001260619.1 Pyr_redox_2 8..355 CDD:285266 139/379 (37%)
pyroxd1NP_001120558.1 Pyr_redox_2 <97..377 CDD:423044 106/297 (36%)
NirB <294..>485 CDD:224171 102/190 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5209
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11758
Inparanoid 1 1.050 378 1.000 Inparanoid score I2027
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1463391at2759
OrthoFinder 1 1.000 - - FOG0006989
OrthoInspector 1 1.000 - - oto105470
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1984
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.