DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and AT4G34920

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_195218.1 Gene:AT4G34920 / 829644 AraportID:AT4G34920 Length:318 Species:Arabidopsis thaliana


Alignment Length:349 Identity:83/349 - (23%)
Similarity:127/349 - (36%) Gaps:120/349 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDHWMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQ 67
            :.:||..|  .|..|::..:..||:|:|.|..|.                   .|...|..::.|
plant    43 RKNWMAGL--TLEKLTLNKIVWPGTHDSATNDIG-------------------IPLISRPLAECQ 86

  Fly    68 SSGTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAMEIFEPLLE--IRQFVDTHPEEVVILDLQHF 130
            |....:||.||.|..|:|: |:|.:.  |||:......:.:::  ||...:|| .|:|||:::..
plant    87 SLSIYEQLVLGTRVLDIRV-QEDRQI--CHGILTSYEIDVVIDDVIRFLSETH-SEIVILEIRTE 147

  Fly   131 YAMTVAHHQKLHKD-----------LIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCP 184
            :.         |||           |.||..|:     |.||.:..::..|  .:.|:.|::...
plant   148 FG---------HKDPPGFETYLADKLGQFLIHQ-----DDSLFNKPVSEIL--PKRVICIWKPRE 196

  Fly   185 IPLPLR---FWPS-YA---W---PTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRY 239
            .|.|.|   .|.| |.   |   ..||      .|.||.|: .|..:||...             
plant   197 SPKPSRGGILWNSDYLKDNWIDTDLPW------TKFQSNLK-HLSEQQPTSS------------- 241

  Fly   240 IAFRLFFTLKSTAKRVDKKLQP-------WIQEQIPGPFEPKDEPRVNVFLADFVSLKG------ 291
               |.||      .||:..:.|       |::     |...:......:|::..|| ||      
plant   242 ---RKFF------YRVENTVTPQADNPVVWVK-----PVTDRIRKHARLFISQCVS-KGCGDKLQ 291

  Fly   292 --------GQFCDWVVDLNTKLLE 307
                    |.|.|..|.|....:|
plant   292 ILSTDFIEGDFVDACVGLTHARIE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 79/335 (24%)
AT4G34920NP_195218.1 PI-PLCc_GDPD_SF 33..313 CDD:387364 82/345 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.