DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and plcxd1

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_691942.1 Gene:plcxd1 / 563489 ZFINID:ZDB-GENE-131127-240 Length:325 Species:Danio rerio


Alignment Length:321 Identity:97/321 - (30%)
Similarity:152/321 - (47%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DHWMRDLPSELRDLSIINLAIPGSHNSMTYGI--NSKSEL---SPDAEISIRRWHR-FFPCFVRR 62
            |:||..|||.|.|..|..:|||||||::||.:  |.:|.:   .||....:.::.: ....||.:
Zfish    16 DNWMAHLPSALWDTPICYMAIPGSHNAITYCLDKNDRSPVDLTQPDMLQKLDKYMKPIIRPFVYK 80

  Fly    63 WSKTQSSGTLDQLELGVRYFDLRIA----QKDDKFYYCHGLFAMEIFEPLL-EIRQFVDTHPEEV 122
            |:..|.|...:||:.||||.|||||    .:.:..|:.||::.....|.:| |||:::|.||:||
Zfish    81 WAIAQESCIREQLDCGVRYCDLRIAHRPNDRSNDLYFYHGVYTTITVETVLKEIREWLDVHPKEV 145

  Fly   123 VILDLQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPL 187
            |||...||..::    |:||..|:........|.:...::..||.:.......|::.|.......
Zfish   146 VILSFSHFLGLS----QELHSLLVSTIKSVFDSKLCPKMERVTLRKLWSEGHQVIVSYEHNTANC 206

  Fly   188 PLRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQG-----YVSQCLITPTGRYIAFRLFFT 247
            ....|...  |..|.||:   |.::.:|:  ..|:.|.|     :|:...:|...:||......:
Zfish   207 NRELWSHI--PYWWANKS---KAEALIEE--FERRKQNGRPGGFFVTGINLTEDLKYICSHPTES 264

  Fly   248 LKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLNTKLLEQ 308
            ||.........|..|:::|.||    .:...:|:...|||:  ..||...|:.||..||.:
Zfish   265 LKDMVMSTYPTLLSWVKQQKPG----SNTGSLNIIAGDFVT--ESQFIPTVIALNENLLNR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 90/307 (29%)
plcxd1XP_691942.1 PI-PLCXD1c 22..313 CDD:176555 90/307 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm24866
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.