DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and Plcxd1

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_997162.2 Gene:Plcxd1 / 403178 MGIID:2685422 Length:357 Species:Mus musculus


Alignment Length:312 Identity:95/312 - (30%)
Similarity:142/312 - (45%) Gaps:24/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCF----VRRWSKT 66
            ||..|..:|.|:.:.:|:|||||::|||.:|.||.:|..:...:....|..|..    |.:||.|
Mouse    57 WMSQLCPQLWDVPLHHLSIPGSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKWSVT 121

  Fly    67 QSSGTLDQLELGVRYFDLRIAQKDD----KFYYCHGLFAMEIFE-PLLEIRQFVDTHPEEVVILD 126
            |:.....||:.||||.|||||...:    ...:.|.::...:.| .|.||.:::.:||.|||||.
Mouse   122 QTLDVTQQLDAGVRYLDLRIAHAPEGSTRNLCFVHMMYTKALVEDTLTEIAEWLQSHPREVVILA 186

  Fly   127 LQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYR-RCPIPLPLR 190
            .::|..||...|..|...::..|...|..:  |.:.  ||.:....::.|::.|. ...:....:
Mouse   187 CRNFEGMTCELHDYLAGCIVNIFGDMLCPS--GEVP--TLRQLWAREQQVIVSYEDEATVSRYDQ 247

  Fly   191 FWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTLKSTAKRV 255
            .||  |.|..|.|......|..|||......:|...:|:...||....||......:|:...:|.
Mouse   248 LWP--AIPYWWGNAVKTDVLLRFLETMKGQGRPDGLFVAGINITENLCYILLHPVDSLEEMTRRS 310

  Fly   256 DKKLQPWIQEQIPGPFEPKDEPR-VNVFLADFVSLKGGQFCDWVVDLNTKLL 306
            ...:..|:..|.||     ..|: .|:...|||...|  |...|:.||.|||
Mouse   311 LPLMTEWVCAQQPG-----QSPQCTNIIAGDFVDADG--FVSKVISLNCKLL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 88/302 (29%)
Plcxd1NP_997162.2 PI-PLCXD1c 61..351 CDD:176555 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.