DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and zgc:64065

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_958491.1 Gene:zgc:64065 / 393379 ZFINID:ZDB-GENE-040426-1355 Length:304 Species:Danio rerio


Alignment Length:314 Identity:90/314 - (28%)
Similarity:144/314 - (45%) Gaps:41/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSE-LSPDAEISIRRWHRFFPC-----FVRRWS 64
            ||..|......:.:..:||||||::|.|.::..|. |.||:.|::    ....|     .|:.||
Zfish    10 WMSKLNETFTTVPLCYIAIPGSHDAMAYSLDMDSPLLEPDSLITM----DLICCGCCRSIVKNWS 70

  Fly    65 KTQSSGTLDQLELGVRYFDLRIAQK--DDKFYYCHGLF-AMEIFEPLLEIRQFVDTHPEEVVILD 126
            .||.....:||:.|:||||||:|.|  ...|::.|||: .:.:.|.:.|:..::..|.:|||||.
Zfish    71 ITQDKTISEQLDAGMRYFDLRVAGKPGSSDFFFYHGLYTTITVKEAMEEVDTWLGKHSKEVVILA 135

  Fly   127 LQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDG--SLKDCTLNRCLEMQRSVVIIY-----RRCP 184
            ..||..|:...|.||...|...|..:|... ||  ||||     |.:....|::.|     ::..
Zfish   136 FSHFKEMSTEQHTKLMTFLKDHFKAKLCPD-DGMPSLKD-----CWDKAYQVILSYDDRNRKQDR 194

  Fly   185 IPLP-LRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTL 248
            :..| :::|        |.|.:...:...||::...|.:|:..:|:...:|..|..|...|..:|
Zfish   195 VLWPGIKYW--------WANNSDPNEAILFLDNKKQSGRPKGFFVAGLNLTFYGCSIFSNLTASL 251

  Fly   249 KSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLN 302
            |.........|..|:::|.||    .|...:|:...||..:  ..|...::.||
Zfish   252 KEKTVTAYPLLLDWVKKQRPG----SDTQSINIIAGDFFDV--NSFAQDIIQLN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 86/308 (28%)
zgc:64065NP_958491.1 PI-PLCXD1c 14..299 CDD:176555 86/308 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4162
OMA 1 1.010 - - QHG48428
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm24866
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.