DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and PLCXD3

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001005473.1 Gene:PLCXD3 / 345557 HGNCID:31822 Length:321 Species:Homo sapiens


Alignment Length:308 Identity:100/308 - (32%)
Similarity:159/308 - (51%) Gaps:22/308 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPC----FVRRWSKT 66
            ||..||..:..:.:.||||||||:|.::.|:..|.:.|:...:::.:...|..    .:|:|..|
Human    15 WMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLAT 79

  Fly    67 QSSGTLDQLELGVRYFDLRIAQK----DDKFYYCHGLFAMEIFEPLLEIRQFVDTHPEEVVILDL 127
            |:.....||..|:|||||||:.|    |::.|:.||||:.::.|.|.||..|:..|.:|||.||.
Human    80 QTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDF 144

  Fly   128 QHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRF- 191
            .|||.|...||:||.:.|...:.:::...:  ..::.:|....|....|::.| ..|:.|.:.| 
Human   145 NHFYGMQKYHHEKLVQMLKDIYGNKMCPAI--FAQEVSLKYLWEKDYQVLVFY-HSPVALEVPFL 206

  Fly   192 WPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQG-YVSQCLITPTGRYIAFRLFFTLKST-AKR 254
            ||....|.||.|....:||..||:.|:..|:.:.. ::||.::||....:...:...|:.| .:|
Human   207 WPGQMMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITER 271

  Fly   255 VDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLN 302
            ....:..|::.|.||      |..:|:..||||.|  |.|...|:.||
Human   272 ALPAMMQWVRTQKPG------ESGINIVTADFVEL--GDFISTVIKLN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 96/302 (32%)
PLCXD3NP_001005473.1 PI-PLCXD1c 19..311 CDD:176555 96/302 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158254
Domainoid 1 1.000 134 1.000 Domainoid score I5026
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48428
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm40808
orthoMCL 1 0.900 - - OOG6_104132
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3805
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.