DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and PLCXD2

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001172035.1 Gene:PLCXD2 / 257068 HGNCID:26462 Length:305 Species:Homo sapiens


Alignment Length:254 Identity:99/254 - (38%)
Similarity:144/254 - (56%) Gaps:11/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHR--FFPCFVRRWSKTQS 68
            ||..||..|.:|.:.||||||||:|.:|.::.||.:.||...:|:|..|  .....:::||.||:
Human    35 WMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQN 99

  Fly    69 SGTLDQLELGVRYFDLRIAQK----DDKFYYCHGLFAMEIFEPLLEIRQFVDTHPEEVVILDLQH 129
            ....:|||.|:||||||::.|    |.:.|:.||||.:::::.|:||..|:..||:|::.||..|
Human   100 LTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNH 164

  Fly   130 FYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRF-WP 193
            ||||...||:.|...:.:.|.::|....  |::..||....|....|:|.| .||......| ||
Human   165 FYAMDETHHKCLVLRIQEAFGNKLCPAC--SVESLTLRTLWEKNCQVLIFY-HCPFYKQYPFLWP 226

  Fly   194 SYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGY-VSQCLITPTGRYIAFRLFFTLKST 251
            ....|.||.|..||:||..|||.:|..|..:..: |||.::||..:.||..|...||:|
Human   227 GKKIPAPWANTTSVRKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 97/250 (39%)
PLCXD2NP_001172035.1 PI-PLCXD1c 39..291 CDD:176555 97/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158252
Domainoid 1 1.000 134 1.000 Domainoid score I5026
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44374
Inparanoid 1 1.050 171 1.000 Inparanoid score I4107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48428
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm40808
orthoMCL 1 0.900 - - OOG6_104132
Panther 1 1.100 - - LDO PTHR13593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3805
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.