DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and Plcxd1

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006249656.1 Gene:Plcxd1 / 100909600 RGDID:1560935 Length:307 Species:Rattus norvegicus


Alignment Length:312 Identity:90/312 - (28%)
Similarity:135/312 - (43%) Gaps:24/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCF----VRRWSKT 66
            ||..|...|.|:.:.:|:|||||::|||.:|.||.:|......:....|..|..    |.:|:.|
  Rat     7 WMSQLCPRLWDVPLHHLSIPGSHDTMTYCLNRKSPISRARSRLLHLLGRVLPFLTGPAVMKWAVT 71

  Fly    67 QSSGTLDQLELGVRYFDLRIAQKDD----KFYYCHGLFAMEIFE-PLLEIRQFVDTHPEEVVILD 126
            |:.....||:.||||.|||||....    ...:.|.::...:.| .|.||.:::..||.||||:.
  Rat    72 QTLDVTRQLDAGVRYLDLRIAHAPGGSARNLCFVHMMYTKALVEDTLTEIAEWLQLHPREVVIVA 136

  Fly   127 LQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYR-RCPIPLPLR 190
            .:.|..||...|..|...::..|...|..:  |.:.  ||.:....::.|::.|. ...:.....
  Rat   137 CRDFEGMTREMHDYLVGCIVNIFGDTLCPS--GEVP--TLGQLWAREQQVLVSYEDEATVSRHDE 197

  Fly   191 FWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTLKSTAKRV 255
            .||  |.|..|.|......|..|||......:|...:|:...:|....|:......:|:...:|.
  Rat   198 LWP--AIPYWWGNAVKTDVLLQFLETKKGHGRPGGLFVAGINVTENLCYVLLHPGDSLEEMTRRS 260

  Fly   256 DKKLQPWIQEQIPGPFEPKDEPR-VNVFLADFVSLKGGQFCDWVVDLNTKLL 306
            ......|::.|.||     ..|. .|:...|||...|  |...|:.||.||:
  Rat   261 VPLTTQWVRAQQPG-----QRPHCTNIIAGDFVGADG--FVSDVISLNQKLV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 84/302 (28%)
Plcxd1XP_006249656.1 PI-PLCXD1c 11..301 CDD:176555 84/302 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X855
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.