DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and plcxd2

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002940157.1 Gene:plcxd2 / 100496710 XenbaseID:XB-GENE-5832516 Length:315 Species:Xenopus tropicalis


Alignment Length:334 Identity:113/334 - (33%)
Similarity:172/334 - (51%) Gaps:49/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHR--FFPCFVRRWSKTQS 68
            ||..||:.|..|.:.||||||||:|.:|.::.||.:.||...:|:|..:  .....:::||.||:
 Frog     9 WMGSLPTSLSSLPLANLAIPGSHDSFSYWVDEKSPVGPDQAATIKRIAKISLVKRLMKKWSVTQN 73

  Fly    69 SGTLDQLELGVRYFDLRIAQKDD----KFYYCHGLFAMEIFEPLLEIRQFVDTHPEEVVILDLQH 129
            ....:|||.|:||||||::.|.:    :.|:.|||:.:::::.|.||.:|:..|.:|:|:||..|
 Frog    74 LTFKEQLESGIRYFDLRVSSKPEEAGKEIYFIHGLYGIKVWDGLEEINKFLTQHNKEIVLLDFNH 138

  Fly   130 FYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLE----MQRSVVIIYRRCPIPLPLR 190
            ||||...||..|...:.:.|..:|.:.      ||..|..|:    .:..|:|.|.       ..
 Frog   139 FYAMDHEHHLYLVNMMQEVFGSKLCTA------DCVENITLQYLWGKKYQVLIFYH-------YN 190

  Fly   191 FWPSYAW-------PTPWPNKASVKKLQSFLEDSLLSRQPQQG--YVSQCLITPTGRYIAFRLFF 246
            .|..|.:       |.||.|..:|:||..|||.:|..|. ::|  :|||.::||..:.|...|..
 Frog   191 LWNEYLYLWSGNKMPAPWANTTNVQKLIQFLETTLTERS-KRGTFHVSQAILTPRVKTIVRGLKS 254

  Fly   247 TLKSTAKRVDKKLQ---PWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLNTKLLEQ 308
            .||:|.  |.:.|.   .|::.|.||..      .||:..:|||.|.  .|.:.|:.||..||:.
 Frog   255 GLKNTL--VHRNLPVILNWVKMQKPGVM------GVNIITSDFVELV--DFAETVIRLNYLLLKT 309

  Fly   309 LAGDKELES 317
               :||..|
 Frog   310 ---NKESSS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 104/313 (33%)
plcxd2XP_002940157.1 PI-PLCXD1c 13..303 CDD:176555 104/313 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11790
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44374
Inparanoid 1 1.050 164 1.000 Inparanoid score I4077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm48004
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3805
SonicParanoid 1 1.000 - - X855
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.