DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and LOC100494672

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002940871.2 Gene:LOC100494672 / 100494672 -ID:- Length:296 Species:Xenopus tropicalis


Alignment Length:294 Identity:61/294 - (20%)
Similarity:109/294 - (37%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMT-YGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQSS 69
            ||..||..   |.:.:|||||:|::|. ||.|.       ||....|    .|            
 Frog    37 WMSYLPDY---LPLSSLAIPGTHDTMAFYGGNL-------AECQCWR----LP------------ 75

  Fly    70 GTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAMEIFEPLL--EIRQFVDTHPEEVVILDLQHFYA 132
               :|.:.|:|:.|:|.....|:....||:.......|::  :...|:..||.|.|::.::..| 
 Frog    76 ---NQYKAGIRFLDIRCRHYQDRLPIHHGISYQRTDFPMVLNDTVTFLMEHPMETVMMRVKEEY- 136

  Fly   133 MTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRFWPSYAW 197
                       |..| .....|.:||.::|.......|...|...:...|..|.:...|......
 Frog   137 -----------DPYQ-NTRSFYKSVDEAVKQVGEQWFLRTTRLPTLGEARGKIVILQDFSAGGEG 189

  Fly   198 PT---PWPNKASVKKLQSFLEDSLLSRQ-------PQQGYVSQCLITPTGRYIAFRLFFTLKSTA 252
            |.   |:|...|:.......:|::...:       .|.|...:..:|.|..  ...|.:..::.|
 Frog   190 PAFGPPYPGSMSISDAYQVNDDAVKWTEVLRHLNVAQNGDPERPFLTYTSG--VHWLLYPPETLA 252

  Fly   253 KRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADF 286
            ::::.::..:::.:..|.     :..|.|.:.||
 Frog   253 RKINPRVYEYLKGKAVGA-----KRSVGVVIMDF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 59/290 (20%)
LOC100494672XP_002940871.2 PI-PLCc_BcPLC_like 38..291 CDD:176528 60/293 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.