DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and plcxd1

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017947131.1 Gene:plcxd1 / 100488047 XenbaseID:XB-GENE-961406 Length:322 Species:Xenopus tropicalis


Alignment Length:327 Identity:106/327 - (32%)
Similarity:148/327 - (45%) Gaps:37/327 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVR----RWSKT 66
            ||..||..|.|:.:.|::|||||:||:|.::..|.|.|:..|.:....:..||..|    ||:||
 Frog    18 WMSQLPEHLWDIPLYNISIPGSHDSMSYCLDKMSPLEPELPILLSVLDKLVPCLARATILRWAKT 82

  Fly    67 QSSGTLDQLELGVRYFDLRIAQKDD----KFYYCHGLFA-MEIFEPLLEIRQFVDTHPEEVVILD 126
            |......||..||||.|||||.:.|    ..|:.||||. :.:.|..|||..::.|:|.|||||.
 Frog    83 QVLNVTQQLNAGVRYLDLRIAHRPDDPSPALYFAHGLFTHITVKEAFLEILAWLLTNPTEVVILS 147

  Fly   127 LQHFYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDC------TLNRCLEMQRSVVIIYRRCPI 185
            .:.....|:.||  ||      ..:.:|| |.|| |.|      ||.....|...|::.|.....
 Frog   148 CRRVQDFTLEHH--LH------LIYCIYS-VFGS-KLCPKHDMPTLRLMWNMGYQVILSYDDTMA 202

  Fly   186 PLPLRFWPSYAWPTPWPNKASVKKLQSFLEDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTLKS 250
            ......|||.  |..|.:..||..|..:||:.....:|...:|:...:|....||....|.::|:
 Frog   203 QFYDFLWPSV--PYWWADTTSVSTLIHYLEERKQEGRPGGFFVAGLNLTENFWYIVTHPFGSMKN 265

  Fly   251 TAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSLKGGQFCDWVVDLNTKLLEQLAGDKEL 315
            ........:..|:|.|.||    |.....|:...|.:.  ...|...|:.||||    |.|::..
 Frog   266 MTIPKLPVMYLWVQNQNPG----KSRHATNIIAEDLIG--SDCFVSAVIHLNTK----LTGERSS 320

  Fly   316 ES 317
            .|
 Frog   321 SS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 97/306 (32%)
plcxd1XP_017947131.1 PI-PLCXD1c 22..311 CDD:176555 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4901
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 1 1.000 - - FOG0001362
OrthoInspector 1 1.000 - - otm48004
Panther 1 1.100 - - O PTHR13593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X855
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.