DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and LOC100331378

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_009290935.1 Gene:LOC100331378 / 100331378 -ID:- Length:289 Species:Danio rerio


Alignment Length:312 Identity:69/312 - (22%)
Similarity:110/312 - (35%) Gaps:95/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDHWMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQ 67
            |..||..|..   ::.|.|:.|||:|::|.....:.:|                 |  :.||.. 
Zfish    37 KTDWMETLDG---NMFISNITIPGTHDTMALHGGAAAE-----------------C--QSWSLE- 78

  Fly    68 SSGTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAME-IFEPLLEI-RQFVDTHPEEVVILDLQHF 130
                 :||..|:||.|||::..:.|  ..||:.:.. .|..:|.| :.|:..|..|.|:|.:   
Zfish    79 -----NQLLAGIRYLDLRVSGNNLK--VVHGVISQHTTFADVLNIVKGFLSQHKSETVLLRV--- 133

  Fly   131 YAMTVAHHQKLHKDLIQFFAHRLYS------TVDGSLKD---CTLNR---CLEMQRSVVIIYRRC 183
                                 :|.|      .|...||:   |.:|.   .||..|..::..::.
Zfish   134 ---------------------KLESKGPFPDDVANQLKNDPGCWVNNEIPQLEDVRGKIVFVQKK 177

  Fly   184 PIPLPLRFWPS-----YAWPTPWPNKAS-VKKLQSFLEDS-----LLSRQPQQGYVSQCLITPTG 237
            ...|.:....:     |........||. ::.|:..||..     :|:.....|:       |.|
Zfish   178 NFKLGVPLLETDKKGDYKVGNVEKKKAKIIEHLKQALEPCEVKAVVLNYSSGTGW-------PLG 235

  Fly   238 RYIAFRLFFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNVFLADFVSL 289
            |         |..|.|.|.||:.||:...:.|..:...:....|...||..|
Zfish   236 R---------LDRTPKNVAKKINPWLYSHLEGASKENIKLCFGVIAMDFPGL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 66/305 (22%)
LOC100331378XP_009290935.1 PI-PLCc_BcPLC_like 41..288 CDD:176528 67/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.