DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and LOC100150005

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_009290940.1 Gene:LOC100150005 / 100150005 -ID:- Length:290 Species:Danio rerio


Alignment Length:297 Identity:65/297 - (21%)
Similarity:111/297 - (37%) Gaps:93/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMT-YGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQSS 69
            ||..|..| :.:|.:|  |||:|::|: :|       .|.||           |        ||.
Zfish    41 WMETLDDE-KLISDVN--IPGTHDTMSLHG-------GPAAE-----------C--------QSW 76

  Fly    70 GTLDQLELGVRYFDLRIAQKDDKFYYCHGL------FAMEIFEPLLEIRQFVDTHPEEVVILDLQ 128
            ...:||..|:||.|||:..:  |....||:      ||    ..|.:...|:..:..|.|::.::
Zfish    77 SLHNQLLAGIRYLDLRVWGR--KLIIVHGVIPQFTTFA----NVLNKTSTFLSQYKTETVLIRVK 135

  Fly   129 HFYAMTVAHH--QKLHKDLIQFFAHRLYSTVDGSLKDCTLNRCLEMQRSVVIIYR---RCPIPLP 188
            |.....:..:  .:|..|             .|......:.|..:::..:|.:.:   :..||| 
Zfish   136 HESKGNIPENVINQLKND-------------PGCWVSDQIPRIGDVRGKIVFVQKNSFKLGIPL- 186

  Fly   189 LRFWPSYAWPTPWPNKASVK-------KLQSFLEDSLLSRQPQQGYVSQCLIT--PTGRYIAFRL 244
                    :.|.......|:       |:...|:.:|.:|:..:..:|....|  |.||      
Zfish   187 --------FETDQRGDYKVRNISEKEDKITEHLKQALGARKTDRAVLSYSSGTGLPLGR------ 237

  Fly   245 FFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRVNV 281
               :..|..||.||:.||:...:      ||..:.|:
Zfish   238 ---IFKTPNRVAKKINPWLYGYL------KDVTKQNL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 63/293 (22%)
LOC100150005XP_009290940.1 PI-PLCc_BcPLC_like 42..289 CDD:176528 64/296 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.