DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and zgc:174938

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001099170.1 Gene:zgc:174938 / 100126020 ZFINID:ZDB-GENE-070928-44 Length:283 Species:Danio rerio


Alignment Length:126 Identity:30/126 - (23%)
Similarity:55/126 - (43%) Gaps:32/126 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIINLAIPGSHNSMTYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQSSG 70
            ||..|..   |..|..:.:||:|::|.....:.:|..|                   |...    
Zfish    37 WMETLND---DKLISEVTVPGTHDTMALHAGAVAECPP-------------------WLLE---- 75

  Fly    71 TLDQLELGVRYFDLRIAQKDDKFYYCHGLFAME-IFEPLLE-IRQFVDTHPEEVVILDLQH 129
              :||..|:||.:||:..::.|.  .||:|:.. .|..::: |:.|:..:..|||::.::|
Zfish    76 --NQLNAGIRYLELRVKGRNLKL--VHGVFSQHTTFSDVVDTIKSFLSHYKTEVVLVQVKH 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 28/122 (23%)
zgc:174938NP_001099170.1 PI-PLCc_BcPLC_like 38..282 CDD:176528 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.