DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and si:dkey-152b24.6

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001373297.1 Gene:si:dkey-152b24.6 / 100002310 ZFINID:ZDB-GENE-100922-31 Length:288 Species:Danio rerio


Alignment Length:332 Identity:64/332 - (19%)
Similarity:111/332 - (33%) Gaps:147/332 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDLPSELRDLSIIN-LAIPGSHNSM-TYGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQS 68
            |||.|.    |..:|: ::|||:|.|: .:|       .|:||           |        ||
Zfish    39 WMRTLD----DNKLISAISIPGTHASLAVHG-------GPEAE-----------C--------QS 73

  Fly    69 SGTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAMEI-FEPLLE-IRQFVDTHPEEVVILDLQHF- 130
            .....||:.|:||.:|.::.:|.|  ..||||.... |..:|. :::|:..|..|||::.::|. 
Zfish    74 WSVESQLKAGIRYLELSVSGRDLK--VVHGLFPQYTRFSKVLNTVKKFLSIHTSEVVLVRVKHVS 136

  Fly   131 ---YAMTVAHHQKLHKD------------------------------LIQF-------FAH---- 151
               :.:.|.:..|...|                              ||:.       .:|    
Zfish   137 WDRFPVKVLNQLKNDPDCWVSDKIPQIKDVRGKIVFVQTNDFKLGISLIETDDKNDYKVSHIGVK 201

  Fly   152 --RLYSTVDGSLKDCTLNRCLEMQRSVVIIYRRCPIPLPLRFWPSYAWPTPWPNKASVKKLQSFL 214
              ::...::.:||||        :..:.::              ||:..|.||            
Zfish   202 EAKIAKHLNEALKDC--------KADLAVL--------------SYSSGTGWP------------ 232

  Fly   215 EDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPRV 279
                                      ..||..|.|..||::::    |:.:.:.|....|.:...
Zfish   233 --------------------------VLRLDLTPKVVAKKINR----WLYDYLGGISSLKSKRCF 267

  Fly   280 NVFLADF 286
            .:...||
Zfish   268 GILAMDF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 61/328 (19%)
si:dkey-152b24.6NP_001373297.1 PI-PLCc_GDPD_SF 40..287 CDD:417475 63/331 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.