DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10747 and si:dkey-152b24.7

DIOPT Version :9

Sequence 1:NP_001260618.1 Gene:CG10747 / 35295 FlyBaseID:FBgn0032845 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001373292.1 Gene:si:dkey-152b24.7 / 100000352 ZFINID:ZDB-GENE-100921-77 Length:288 Species:Danio rerio


Alignment Length:333 Identity:64/333 - (19%)
Similarity:106/333 - (31%) Gaps:149/333 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WMRDL-PSELRDLSIINLAIPGSHNSMT-YGINSKSELSPDAEISIRRWHRFFPCFVRRWSKTQS 68
            ||:.| .|:|    |.::.|||:|::|. :|       .|.||           |  :.||..  
Zfish    40 WMKTLDDSKL----ISHITIPGTHDTMALHG-------GPAAE-----------C--QSWSLE-- 78

  Fly    69 SGTLDQLELGVRYFDLRIAQKDDKFYYCHGLFAME-IFEPLLE-IRQFVDTHPEEVVILDLQH-- 129
                |||:.|:||.|||:...|.|.  .||:.:.. .|...:: |:.|:..|..|.|::.::|  
Zfish    79 ----DQLKAGIRYLDLRVNGNDLKL--VHGVISQHTTFSDAIDTIKSFLSQHKTEAVLVRVKHQS 137

  Fly   130 ---FYAMTVAHHQKLHKDLIQFFAHRLYSTVDGSLKDCTLN----RCLEMQRSVVIIYRR----- 182
               |.|..:   .:|..|                 .||.::    |..|::..:|.:.:.     
Zfish   138 NGPFPANVL---NELKND-----------------PDCWVSDKIPRIREVRGKIVFVQKNNFKLG 182

  Fly   183 ----------------------------------CPIPLPLRFWPSYAWPTPWPNKASVKKLQSF 213
                                              |...:.:.   ||:..|.||           
Zfish   183 IVLLETDEKDDYKVSHVKIKEAEITDHLNEALKDCKADIAVL---SYSSGTGWP----------- 233

  Fly   214 LEDSLLSRQPQQGYVSQCLITPTGRYIAFRLFFTLKSTAKRVDKKLQPWIQEQIPGPFEPKDEPR 278
                                           ...|::|.|||.|::.||:...:....|...:..
Zfish   234 -------------------------------LLRLENTPKRVAKEINPWLYNHLQDLSEQNPKVC 267

  Fly   279 VNVFLADF 286
            ..:...||
Zfish   268 FGILAMDF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10747NP_001260618.1 PI-PLCXD1c 10..302 CDD:176555 62/329 (19%)
si:dkey-152b24.7NP_001373292.1 PI-PLCc_BcPLC_like 41..287 CDD:176528 63/332 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4306
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.