DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neb and CG5004

DIOPT Version :9

Sequence 1:NP_476817.1 Gene:neb / 35293 FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster
Sequence 2:NP_573195.1 Gene:CG5004 / 32698 FlyBaseID:FBgn0260748 Length:1247 Species:Drosophila melanogaster


Alignment Length:417 Identity:83/417 - (19%)
Similarity:142/417 - (34%) Gaps:134/417 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 LVRIGRGRLPGG-------------SSSSQPDIVLDGPLVALQHCSIEHERGGKLYVIPGSEDFE 708
            ||.:|.|||...             .|::...|.|:|..|...||:|......::.::| .:|..
  Fly    19 LVSLGGGRLSTAVTIHYIHIGDTTIGSAASCSISLNGSGVRPLHCTIYRSDANEVTLVP-EKDSR 82

  Fly   709 TYVNGELLKDRRQLFHGDRLVIGGSHYFRISNPFCSQRGKADHPVDFQLAHQEILQKQEQQLRSE 773
            ..::|..:.:..:|..|..:.||.|:|.|.:||                       .:.|.:||.
  Fly    83 LLIDGAPILEETKLSQGAMITIGNSNYLRFNNP-----------------------DEAQMMRSA 124

  Fly   774 LEAEKRAALTKIEQERAQHARDFEERLQCLELEQF--------------KYKC----NSEMLETE 820
            :.:.:|.::.:|  :..|.||...|..|.||||.|              :.:|    :|:::...
  Fly   125 MGSNERISMPQI--DFTQSARQAHELSQSLELESFYESIINPINNPSTYELECPKVFSSDLVTVN 187

  Fly   821 RQALALAQQ----------QEHTPLRHEDAVSTPAQKSTILEDIQRIMLNPSEESLHKTQLMVKE 875
            ..|..:..|          :.|   |:|..::....|.        :..|....::.....:.||
  Fly   188 MPAKDVLGQKYASFARNLAENH---RNEKQLNNQYAKG--------VGSNGGYWNVPSNAAIYKE 241

  Fly   876 ATQRCRQLDLPLEFRQTQTPDEFGLLRTVILILDKQRGLKAE-WPTA-------RLGVWLDL--- 929
            ..|:..|          |.|.:         :|.|....:.: :|.|       ..||..|:   
  Fly   242 QHQQQHQ----------QAPQD---------LLTKVNNDRYDRYPKAGGLQIYSMNGVNSDINNG 287

  Fly   930 --------VRDNAEQQEKLNATTIFQSVEVDWEPLDADLNETLSDTHN---SSRIALNLSAMKDV 983
                    ....||.::.|...|.:           ||.|.::..|||   :|.|..:......:
  Fly   288 PATGNNSGTGGGAELEDMLKICTEY-----------ADRNNSMPSTHNVSSTSSITSSPIVQNRI 341

  Fly   984 LLNKPLKRLLNASSSKSNTPRQTSTPS 1010
            ..|..|.|    ..:||..|:|....|
  Fly   342 KTNGSLPR----DKNKSPFPQQAGVAS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816
KISc 120..525 CDD:214526
Kinesin_assoc 524..657 CDD:292801 83/417 (20%)
FHA 634..740 CDD:238017 24/95 (25%)
CG5004NP_573195.1 FHA 41..104 CDD:278899 13/63 (21%)
PH-like 1142..1242 CDD:302622
PH 1143..1237 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.