DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neb and CG32318

DIOPT Version :9

Sequence 1:NP_476817.1 Gene:neb / 35293 FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:51/103 - (49%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NMIVAVRVRPLNALE-CTRGQVTNVVQVHGNSNELTVQAGSSADASAGVTHFFSYDQVYYSCDPE 183
            |:.|.|||||||:.| |.|.  ..||.|.|....:|.....|.     :|..|::|:   |..||
  Fly    19 NIQVYVRVRPLNSRERCIRS--AEVVDVVGPREVVTRHTLDSK-----LTKKFTFDR---SFGPE 73

  Fly   184 RKNFACQAKVFEGTARPLIDTAFEGYNACLFAYGQTGS 221
            .|    |..|:.....|||:....|||..:|||||||:
  Fly    74 SK----QCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816 40/103 (39%)
KISc 120..525 CDD:214526 40/103 (39%)
Kinesin_assoc 524..657 CDD:292801
FHA 634..740 CDD:238017
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 38/100 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.