DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pr and Pts

DIOPT Version :9

Sequence 1:NP_724244.1 Gene:pr / 35292 FlyBaseID:FBgn0003141 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_035350.1 Gene:Pts / 19286 MGIID:1338783 Length:144 Species:Mus musculus


Alignment Length:134 Identity:83/134 - (61%)
Similarity:102/134 - (76%) Gaps:1/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVLNITEL 71
            |.|:|..:|||.||||||.|||.|||.|||||||.:||||||.|.:||.|.||..||||:|:|:|
Mouse    11 ARLSRLVSFSASHRLHSPSLSDEENLRVFGKCNNPNGHGHNYKVVVTVHGEIDPVTGMVMNLTDL 75

  Fly    72 KEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKIHETPKNII 136
            ||.:|..|||.|||||||.||.|||:..|||||:|||||:::: :|.....||:||:.||..||:
Mouse    76 KEYMEEAIMKPLDHKNLDLDVPYFADAVSTTENVAVYIWESLQ-KLLPVGALYKVKVFETDNNIV 139

  Fly   137 SYRG 140
            .|:|
Mouse   140 VYKG 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prNP_724244.1 PTPS 6..141 CDD:238264 83/134 (62%)
PtsNP_035350.1 PTPS 17..144 CDD:279567 80/128 (63%)
PTPS 17..144 CDD:238264 80/128 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835699
Domainoid 1 1.000 166 1.000 Domainoid score I3881
eggNOG 1 0.900 - - E1_COG0720
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H268
Inparanoid 1 1.050 167 1.000 Inparanoid score I4163
Isobase 1 0.950 - 0 Normalized mean entropy S2707
OMA 1 1.010 - - QHG55855
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005629
OrthoInspector 1 1.000 - - oto93026
orthoMCL 1 0.900 - - OOG6_101657
Panther 1 1.100 - - LDO PTHR12589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2738
SonicParanoid 1 1.000 - - X5304
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.