DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pr and ptps-1

DIOPT Version :9

Sequence 1:NP_724244.1 Gene:pr / 35292 FlyBaseID:FBgn0003141 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001040626.1 Gene:ptps-1 / 181823 WormBaseID:WBGene00015010 Length:140 Species:Caenorhabditis elegans


Alignment Length:140 Identity:68/140 - (48%)
Similarity:105/140 - (75%) Gaps:1/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMV 65
            |.:.|:..:.|.::|||.|||||.:||||||.|.||||||.:||||||..::.:||.:|..:|||
 Worm     1 MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMV 65

  Fly    66 LNITELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKIHE 130
            .::.:||:.: ::::..:||:|||||||:|..|.||:||:|:|:::.::..:..|.:||:|.|.|
 Worm    66 YDLAKLKKEM-SLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEE 129

  Fly   131 TPKNIISYRG 140
            |||||.:|:|
 Worm   130 TPKNIFTYKG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prNP_724244.1 PTPS 6..141 CDD:238264 66/135 (49%)
ptps-1NP_001040626.1 TFold 6..139 CDD:294189 65/133 (49%)
PTPS 11..139 CDD:279567 65/128 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158664
Domainoid 1 1.000 150 1.000 Domainoid score I2705
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H268
Inparanoid 1 1.050 154 1.000 Inparanoid score I2925
Isobase 1 0.950 - 0 Normalized mean entropy S2707
OMA 1 1.010 - - QHG55855
OrthoDB 1 1.010 - - D1502673at2759
OrthoFinder 1 1.000 - - FOG0005629
OrthoInspector 1 1.000 - - oto17420
orthoMCL 1 0.900 - - OOG6_101657
Panther 1 1.100 - - LDO PTHR12589
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2738
SonicParanoid 1 1.000 - - X5304
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.890

Return to query results.
Submit another query.