DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pr and ptps-1

DIOPT Version :10

Sequence 1:NP_724244.1 Gene:pr / 35292 FlyBaseID:FBgn0003141 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001040626.1 Gene:ptps-1 / 181823 WormBaseID:WBGene00015010 Length:140 Species:Caenorhabditis elegans


Alignment Length:140 Identity:68/140 - (48%)
Similarity:105/140 - (75%) Gaps:1/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQQPVAFLTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMV 65
            |.:.|:..:.|.::|||.|||||.:||||||.|.||||||.:||||||..::.:||.:|..:|||
 Worm     1 MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMV 65

  Fly    66 LNITELKEAIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPELLYEVKIHE 130
            .::.:||:.: ::::..:||:|||||||:|..|.||:||:|:|:::.::..:..|.:||:|.|.|
 Worm    66 YDLAKLKKEM-SLVLDTVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEE 129

  Fly   131 TPKNIISYRG 140
            |||||.:|:|
 Worm   130 TPKNIFTYKG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prNP_724244.1 PTPS 6..141 CDD:238264 66/135 (49%)
ptps-1NP_001040626.1 TFold 6..139 CDD:469697 65/133 (49%)

Return to query results.
Submit another query.