DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pr and pts

DIOPT Version :9

Sequence 1:NP_724244.1 Gene:pr / 35292 FlyBaseID:FBgn0003141 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_002937697.2 Gene:pts / 100487259 XenbaseID:XB-GENE-6047579 Length:170 Species:Xenopus tropicalis


Alignment Length:133 Identity:76/133 - (57%)
Similarity:94/133 - (70%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTRRETFSACHRLHSPQLSDAENLEVFGKCNNFHGHGHNYTVEITVRGPIDRRTGMVLNITELKE 73
            ::|..:|||.|||||..||:.||..:||||||.:||||||.|.:||||.||..||||:|:|:||:
 Frog    39 ISRGLSFSASHRLHSNSLSEEENKRIFGKCNNPNGHGHNYKVIVTVRGKIDPTTGMVINLTDLKK 103

  Fly    74 AIETVIMKRLDHKNLDKDVEYFANTPSTTENLAVYIWDNIRLQLKKPE-LLYEVKIHETPKNIIS 137
            .:|..|...|||||:||||.||.|..||.||:.|:||:  .||.:.|. |||||.:|||..|...
 Frog   104 YMEECITVPLDHKNVDKDVPYFRNVVSTVENITVFIWE--ELQKRLPAGLLYEVCVHETDSNSAV 166

  Fly   138 YRG 140
            |||
 Frog   167 YRG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prNP_724244.1 PTPS 6..141 CDD:238264 76/133 (57%)
ptsXP_002937697.2 PTPS 36..170 CDD:238264 76/133 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4322
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H268
Inparanoid 1 1.050 151 1.000 Inparanoid score I4254
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502673at2759
OrthoFinder 1 1.000 - - FOG0005629
OrthoInspector 1 1.000 - - oto103283
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5304
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.