DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vls and PFS2

DIOPT Version :9

Sequence 1:NP_610019.2 Gene:vls / 35289 FlyBaseID:FBgn0003978 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_014082.1 Gene:PFS2 / 855399 SGDID:S000005261 Length:465 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:46/232 - (19%)
Similarity:90/232 - (38%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GRDQM-------HHMSVDSANFKLQAEHTVNIVRYA-EDDFLLVALGDTRLQAWSTYSKVRDSQS 140
            |||::       .|:|.:      :.:|.:..:::. |...|:||........|:..|...::. 
Yeast    73 GRDRVINLPSKFTHLSSN------KVKHVIPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETL- 130

  Fly   141 PYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLNVWDLSGADMVSTYRSRSSHTDKLTG 205
                     ..||.:.::.:. :..|....:||.||..:.:|. ....||.  ...::||:.:..
Yeast   131 ---------MQAHDSAVTTMK-YSHDSDWMISGDADGMIKIWQ-PNFSMVK--EIDAAHTESIRD 182

  Fly   206 LATPAASVDKFVTCDRGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAW-------AAASELQG 263
            :|. :::..|||||......::|:..........    :.|.....|..|       |:||:   
Yeast   183 MAF-SSNDSKFVTCSDDNILKIWNFSNGKQERVL----SGHHWDVKSCDWHPEMGLIASASK--- 239

  Fly   264 DNHIYLGD-YDGKVHTLDIRVPRKLAETREYFDKGHV 299
            ||.:.|.| ..|...:..::....:.:||....||::
Yeast   240 DNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlsNP_610019.2 WD40 106..>282 CDD:295369 36/184 (20%)
WD40 <134..>358 CDD:225201 34/174 (20%)
WD40 repeat 157..198 CDD:293791 8/40 (20%)
WD40 repeat 204..245 CDD:293791 7/40 (18%)
WD40 repeat 250..281 CDD:293791 10/38 (26%)
WD40 repeat 289..335 CDD:293791 4/11 (36%)
PFS2NP_014082.1 WD40 93..377 CDD:238121 41/206 (20%)
WD40 repeat 98..133 CDD:293791 6/44 (14%)
WD40 repeat 139..175 CDD:293791 8/39 (21%)
WD40 repeat 180..216 CDD:293791 7/40 (18%)
WD40 repeat 223..257 CDD:293791 10/36 (28%)
WD40 repeat 264..299 CDD:293791 4/13 (31%)
WD40 repeat 307..346 CDD:293791
WD40 repeat 353..377 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0284
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.