Sequence 1: | NP_610019.2 | Gene: | vls / 35289 | FlyBaseID: | FBgn0003978 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060853.3 | Gene: | WDR33 / 55339 | HGNCID: | 25651 | Length: | 1336 | Species: | Homo sapiens |
Alignment Length: | 246 | Identity: | 53/246 - (21%) |
---|---|---|---|
Similarity: | 80/246 - (32%) | Gaps: | 88/246 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 EGRQ------------WWGMLFGYGRDQMHHMSVDSANFK--LQA-EHTVNIVRYAEDD-FLLVA 120
Fly 121 LGDTRLQAW-STYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLNVWDL 184
Fly 185 -----------SGADM----------VSTYRSRSSHT-----DKLTG--LATPAASVDK------ 215
Fly 216 ------FVTCDRGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAWAAASE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vls | NP_610019.2 | WD40 | 106..>282 | CDD:295369 | 42/197 (21%) |
WD40 | <134..>358 | CDD:225201 | 36/167 (22%) | ||
WD40 repeat | 157..198 | CDD:293791 | 13/61 (21%) | ||
WD40 repeat | 204..245 | CDD:293791 | 12/54 (22%) | ||
WD40 repeat | 250..281 | CDD:293791 | 4/11 (36%) | ||
WD40 repeat | 289..335 | CDD:293791 | |||
WDR33 | NP_060853.3 | WD 1 | 117..156 | 8/40 (20%) | |
WD40 | 121..>405 | CDD:225201 | 53/246 (22%) | ||
WD40 | 121..402 | CDD:238121 | 53/246 (22%) | ||
WD40 repeat | 122..159 | CDD:293791 | 9/43 (21%) | ||
WD 2 | 159..198 | 8/38 (21%) | |||
WD40 repeat | 165..200 | CDD:293791 | 7/46 (15%) | ||
WD 3 | 200..239 | 11/39 (28%) | |||
WD40 repeat | 205..241 | CDD:293791 | 9/36 (25%) | ||
WD 4 | 242..283 | 9/40 (23%) | |||
WD40 repeat | 248..285 | CDD:293791 | 8/36 (22%) | ||
WD 5 | 286..325 | 6/41 (15%) | |||
WD40 repeat | 291..328 | CDD:293791 | 6/39 (15%) | ||
WD 6 | 329..369 | 5/16 (31%) | |||
WD40 repeat | 336..371 | CDD:293791 | 3/9 (33%) | ||
WD 7 | 373..412 | ||||
WD40 repeat | 378..402 | CDD:293791 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 568..1336 | ||||
Med15 | 594..>989 | CDD:255446 | |||
Collagen | 730..791 | CDD:189968 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0284 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |