DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vls and WDR33

DIOPT Version :9

Sequence 1:NP_610019.2 Gene:vls / 35289 FlyBaseID:FBgn0003978 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_060853.3 Gene:WDR33 / 55339 HGNCID:25651 Length:1336 Species:Homo sapiens


Alignment Length:246 Identity:53/246 - (21%)
Similarity:80/246 - (32%) Gaps:88/246 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EGRQ------------WWGMLFGYGRDQMHHMSVDSANFK--LQA-EHTVNIVRYAEDD-FLLVA 120
            |||:            |.|:.|               ||:  ||| :..|..:.::.:| ::|.|
Human   130 EGRRLVTGASSGEFTLWNGLTF---------------NFETILQAHDSPVRAMTWSHNDMWMLTA 179

  Fly   121 LGDTRLQAW-STYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLNVWDL 184
            .....::.| |..:.|:..|            ||...|.:.|....|.:.|.. |.|.|:.:||.
Human   180 DHGGYVKYWQSNMNNVKMFQ------------AHKEAIREASFSPTDNKFATC-SDDGTVRIWDF 231

  Fly   185 -----------SGADM----------VSTYRSRSSHT-----DKLTG--LATPAASVDK------ 215
                       .|||:          :....|:.|..     |..||  |||..|..:.      
Human   232 LRCHEERILRGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKL 296

  Fly   216 ------FVTCDRGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAWAAASE 260
                  .:|..|....:|:|:|.....   |.....|....|:.||....|
Human   297 NLNGNWLLTASRDHLCKLFDIRNLKEE---LQVFRGHKKEATAVAWHPVHE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlsNP_610019.2 WD40 106..>282 CDD:295369 42/197 (21%)
WD40 <134..>358 CDD:225201 36/167 (22%)
WD40 repeat 157..198 CDD:293791 13/61 (21%)
WD40 repeat 204..245 CDD:293791 12/54 (22%)
WD40 repeat 250..281 CDD:293791 4/11 (36%)
WD40 repeat 289..335 CDD:293791
WDR33NP_060853.3 WD 1 117..156 8/40 (20%)
WD40 121..>405 CDD:225201 53/246 (22%)
WD40 121..402 CDD:238121 53/246 (22%)
WD40 repeat 122..159 CDD:293791 9/43 (21%)
WD 2 159..198 8/38 (21%)
WD40 repeat 165..200 CDD:293791 7/46 (15%)
WD 3 200..239 11/39 (28%)
WD40 repeat 205..241 CDD:293791 9/36 (25%)
WD 4 242..283 9/40 (23%)
WD40 repeat 248..285 CDD:293791 8/36 (22%)
WD 5 286..325 6/41 (15%)
WD40 repeat 291..328 CDD:293791 6/39 (15%)
WD 6 329..369 5/16 (31%)
WD40 repeat 336..371 CDD:293791 3/9 (33%)
WD 7 373..412
WD40 repeat 378..402 CDD:293791
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 568..1336
Med15 594..>989 CDD:255446
Collagen 730..791 CDD:189968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0284
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.