Sequence 1: | NP_610019.2 | Gene: | vls / 35289 | FlyBaseID: | FBgn0003978 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001181857.1 | Gene: | wdr33 / 449009 | ZFINID: | ZDB-GENE-040924-3 | Length: | 1102 | Species: | Danio rerio |
Alignment Length: | 255 | Identity: | 57/255 - (22%) |
---|---|---|---|
Similarity: | 87/255 - (34%) | Gaps: | 82/255 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 EGRQ------------WWGMLFGYGRDQMHHMSVDSANFK--LQA-EHTVNIVRYAEDD-FLLVA 120
Fly 121 LGDTRLQAW-STYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLNVWDL 184
Fly 185 -----------SGADMVSTYRSRSSHTDKLTGLATPAASVDKFVTCDRGGCARLWDVRAAAPSST 238
Fly 239 CLYADASHVLSFTSAAWAAASELQGDNHIYLGDYDGKVHTLDIRVPRKLAETREYFDKGH 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vls | NP_610019.2 | WD40 | 106..>282 | CDD:295369 | 39/188 (21%) |
WD40 | <134..>358 | CDD:225201 | 40/176 (23%) | ||
WD40 repeat | 157..198 | CDD:293791 | 12/51 (24%) | ||
WD40 repeat | 204..245 | CDD:293791 | 8/40 (20%) | ||
WD40 repeat | 250..281 | CDD:293791 | 5/30 (17%) | ||
WD40 repeat | 289..335 | CDD:293791 | 4/10 (40%) | ||
wdr33 | NP_001181857.1 | WD40 | 121..>405 | CDD:225201 | 57/255 (22%) |
WD40 | 121..402 | CDD:238121 | 57/255 (22%) | ||
WD40 repeat | 122..159 | CDD:293791 | 9/43 (21%) | ||
WD40 repeat | 165..200 | CDD:293791 | 7/46 (15%) | ||
WD40 repeat | 205..241 | CDD:293791 | 9/36 (25%) | ||
WD40 repeat | 248..285 | CDD:293791 | 8/46 (17%) | ||
WD40 repeat | 291..328 | CDD:293791 | 12/48 (25%) | ||
WD40 repeat | 336..371 | CDD:293791 | |||
WD40 repeat | 378..402 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0284 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |