DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vls and Wdr33

DIOPT Version :9

Sequence 1:NP_610019.2 Gene:vls / 35289 FlyBaseID:FBgn0003978 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_730982.1 Gene:Wdr33 / 40698 FlyBaseID:FBgn0046222 Length:807 Species:Drosophila melanogaster


Alignment Length:338 Identity:72/338 - (21%)
Similarity:115/338 - (34%) Gaps:128/338 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ATNRR-----------EGRQ------------WWGMLFGYGRDQMHHMSVDSANFK--LQAEHTV 106
            |||:.           |||:            |.|:.|               ||:  ||| |.:
  Fly   141 ATNKMRCPIFTLAWTPEGRRLVTGASSGEFTLWNGLTF---------------NFETILQA-HDI 189

  Fly   107 NI--VRYAEDDFLLVALGD--TRLQAW-STYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKAD 166
            ::  :.::.:|..:|. ||  ..::.| |..:.|:..|            ||...|..:|....|
  Fly   190 SVRTMVWSHNDSWMVT-GDHGGYVKYWQSNMNNVKMYQ------------AHKEAIRGISFSPTD 241

  Fly   167 PRTAVSGSADSTLNVWDL-----------SGADMVSTYRSRSSHTDKLTGLATPAASVDKFVTCD 220
            .: .||||.|.||.:||.           .|||:      :..|.....|:....:.       |
  Fly   242 SK-FVSGSDDGTLRIWDFMRCQEERVLRGHGADV------KCVHWHPQKGMIVSGSK-------D 292

  Fly   221 RGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAWAAASELQGDNHIYL--GDYDGKVHTLDIRV 283
            .....::||.::....:| |:|..|.|:..   .|       .||..:|  ...|..:...||  
  Fly   293 NQQPIKIWDPKSGIALAT-LHAHKSTVMDL---KW-------NDNGNWLVTASRDHLLKLFDI-- 344

  Fly   284 PRKLAETREYFDKGHVAQ------------LLINGPHLAAMS--NLPASVKVANVQAGHEFIYTH 334
             |.|.|..:.| :||..:            |..:|....::.  |:....::..|:..|:.|   
  Fly   345 -RNLREEVQVF-RGHKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKEIGCVETAHDSI--- 404

  Fly   335 QDTHSRLTDAVWT 347
                      |||
  Fly   405 ----------VWT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlsNP_610019.2 WD40 106..>282 CDD:295369 41/193 (21%)
WD40 <134..>358 CDD:225201 51/241 (21%)
WD40 repeat 157..198 CDD:293791 15/51 (29%)
WD40 repeat 204..245 CDD:293791 7/40 (18%)
WD40 repeat 250..281 CDD:293791 5/32 (16%)
WD40 repeat 289..335 CDD:293791 10/59 (17%)
Wdr33NP_730982.1 WD40 146..429 CDD:238121 69/333 (21%)
WD40 148..>432 CDD:225201 69/331 (21%)
WD40 repeat 149..186 CDD:293791 9/51 (18%)
WD40 repeat 192..227 CDD:293791 8/47 (17%)
WD40 repeat 232..268 CDD:293791 12/36 (33%)
WD40 repeat 275..312 CDD:293791 6/44 (14%)
WD40 repeat 318..355 CDD:293791 12/50 (24%)
WD40 repeat 362..398 CDD:293791 3/35 (9%)
WD40 repeat 405..429 CDD:293791 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0284
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.