| Sequence 1: | NP_610019.2 | Gene: | vls / 35289 | FlyBaseID: | FBgn0003978 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001100868.2 | Gene: | Wdr33 / 307524 | RGDID: | 1309230 | Length: | 1331 | Species: | Rattus norvegicus |
| Alignment Length: | 246 | Identity: | 53/246 - (21%) |
|---|---|---|---|
| Similarity: | 80/246 - (32%) | Gaps: | 88/246 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 EGRQ------------WWGMLFGYGRDQMHHMSVDSANFK--LQA-EHTVNIVRYAEDD-FLLVA 120
Fly 121 LGDTRLQAW-STYSKVRDSQSPYCLFLVGESSAHPTPISQLSVFKADPRTAVSGSADSTLNVWDL 184
Fly 185 -----------SGADM----------VSTYRSRSSHT-----DKLTG--LATPAASVDK------ 215
Fly 216 ------FVTCDRGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAWAAASE 260 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| vls | NP_610019.2 | WD40 | 106..>282 | CDD:295369 | 42/197 (21%) |
| WD40 | <134..>358 | CDD:225201 | 36/167 (22%) | ||
| WD40 repeat | 157..198 | CDD:293791 | 13/61 (21%) | ||
| WD40 repeat | 204..245 | CDD:293791 | 12/54 (22%) | ||
| WD40 repeat | 250..281 | CDD:293791 | 4/11 (36%) | ||
| WD40 repeat | 289..335 | CDD:293791 | |||
| Wdr33 | NP_001100868.2 | WD40 | 121..>405 | CDD:225201 | 53/246 (22%) |
| WD40 | 121..402 | CDD:238121 | 53/246 (22%) | ||
| WD40 repeat | 122..159 | CDD:293791 | 9/43 (21%) | ||
| WD40 repeat | 165..200 | CDD:293791 | 7/46 (15%) | ||
| WD40 repeat | 205..241 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 248..285 | CDD:293791 | 8/36 (22%) | ||
| WD40 repeat | 291..328 | CDD:293791 | 6/39 (15%) | ||
| WD40 repeat | 336..371 | CDD:293791 | 3/9 (33%) | ||
| WD40 repeat | 378..402 | CDD:293791 | |||
| Med15 | 565..>972 | CDD:255446 | |||
| Collagen | 717..769 | CDD:189968 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0284 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||