DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vls and wdr77

DIOPT Version :9

Sequence 1:NP_610019.2 Gene:vls / 35289 FlyBaseID:FBgn0003978 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001120009.1 Gene:wdr77 / 100144971 XenbaseID:XB-GENE-972898 Length:333 Species:Xenopus tropicalis


Alignment Length:315 Identity:77/315 - (24%)
Similarity:134/315 - (42%) Gaps:45/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LALATNRREGRQWWGMLFGY-GRDQMHHMSVDSANFKLQAEHTVNIVRYAEDDFLLVALGDTRLQ 127
            |.||.:....|.|.|.::.: ..|...:.|:.:|.  :|.|..|..|.:..:..:|||.....::
 Frog    32 LLLAASSLSSRTWGGSIWVFKDPDSAPNESLCTAG--VQTEAGVTDVAWVSEKGILVASDSGAVE 94

  Fly   128 AWSTYSKVRDSQSPYCLFLVGESS--AHPTPISQLSVFKADPRTAVSGSADSTLNVWDLSGADMV 190
            .|    ::.:.:|    .||.:.:  .|...:..|||| :|...||||..|.::.||||:...::
 Frog    95 LW----EILEKES----LLVNKFTKYEHDDIVKSLSVF-SDGTQAVSGGKDFSVKVWDLTQKTLL 150

  Fly   191 STYRSRSSHTDKLTGLATPAASVDKFVTCDRGGCARLWDVRAAAPSSTCLYADASHVLSFTSAAW 255
            ::|.:.||..:.:.  |.|.... .|::|...|...|||.|...|::...:.....:.  ||..|
 Frog   151 NSYIAHSSEVNCVA--ACPGKEA-IFLSCGEDGKILLWDTRKPKPATRIDFFTPDTIP--TSVTW 210

  Fly   256 AAASELQGDNHIYLGDYDGKVHTLDIRVPRKLAETREYFDKGHVAQLLING--------PHLAAM 312
                ..:.|:....||..|.|:.::::       ..:...|..|....|.|        |:||::
 Frog   211 ----HPEKDDTFACGDEIGNVYLVNLK-------NLDSVQKSSVHSQSITGLAYSYHSSPYLASI 264

  Fly   313 SNLPASVKVANVQAGHEF-IYTHQDTHSRLTDAVWT--DDSTLITIGHGRKMVTH 364
            |. ..:|.|.:......| ..:|:|.   :|...|:  |.|...|:|...|::.|
 Frog   265 SE-DCTVAVYDSDFSEAFRDLSHRDF---VTGVAWSPLDHSKFTTVGWDHKVLHH 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vlsNP_610019.2 WD40 106..>282 CDD:295369 45/177 (25%)
WD40 <134..>358 CDD:225201 58/236 (25%)
WD40 repeat 157..198 CDD:293791 15/40 (38%)
WD40 repeat 204..245 CDD:293791 10/40 (25%)
WD40 repeat 250..281 CDD:293791 8/30 (27%)
WD40 repeat 289..335 CDD:293791 11/54 (20%)
wdr77NP_001120009.1 WD40 <43..312 CDD:225201 71/299 (24%)
WD40 70..>297 CDD:295369 61/255 (24%)
WD40 repeat 73..110 CDD:293791 9/44 (20%)
WD40 repeat 119..154 CDD:293791 14/35 (40%)
WD40 repeat 160..197 CDD:293791 10/39 (26%)
WD40 repeat 205..242 CDD:293791 9/49 (18%)
WD40 repeat 248..273 CDD:293791 7/25 (28%)
WD40 repeat 290..312 CDD:293791 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50221
OrthoDB 1 1.010 - - D337178at33208
OrthoFinder 1 1.000 - - FOG0007197
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46853
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.