DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and PSKH2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_016869418.1 Gene:PSKH2 / 85481 HGNCID:18997 Length:504 Species:Homo sapiens


Alignment Length:272 Identity:94/272 - (34%)
Similarity:155/272 - (56%) Gaps:14/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLS 236
            :.|.:...:|:|::..|..|....|.:.||:|:::.....|.         :..::|..:::.:|
Human   180 RRYDIKALIGTGSFSRVVRVEQKTTKKPFAIKVMETREREGR---------EACVSELSVLRRVS 235

  Fly   237 HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITH 301
            |..:|::.:|.:..|.||||:|...||:|.:|:|:....:|..:......:...::|||...|||
Human   236 HRYIVQLMEIFETEDQVYMVMELATGGELFDRLIAQGSFTERDAVRILQMVADGIRYLHALQITH 300

  Fly   302 RDLKPDNVLLETNDEETLLKVSDFGLSKFVQK--DSVMRTLCGTPLYVAPEVLITGGREAYTKKV 364
            |:|||:|:|.....||:.:.::||||:...:|  |..|:||||||.|:|||||:   |:.||..|
Human   301 RNLKPENLLYYHPGEESKILITDFGLAYSGKKSGDWTMKTLCGTPEYIAPEVLL---RKPYTSAV 362

  Fly   365 DIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERR 429
            |:|:|||:.:..|||.|||.||..|...::|.||::.|....|.|:|..||..|:::||::...|
Human   363 DMWALGVITYALLSGFLPFDDESQTRLYRKILKGKYNYTGEPWPSISHLAKDFIDKLLILEAGHR 427

  Fly   430 PSIDDVLQSSWL 441
            .|....|...|:
Human   428 MSAGQALDHPWV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 93/270 (34%)
S_TKc 174..441 CDD:214567 93/268 (35%)
PSKH2XP_016869418.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.