DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and MEK1

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:423 Identity:121/423 - (28%)
Similarity:194/423 - (45%) Gaps:91/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KRANCELTNP---------------------VYIQDLSRNGTFVNNEKIGTNRMRILKNDDVISL 145
            |.....||||                     .|::|.|.|||::|...:..::..:||:.|||.|
Yeast    54 KECQLVLTNPSISSVHCVFWCVFFDEDSIPMFYVKDCSLNGTYLNGLLLKRDKTYLLKHCDVIEL 118

  Fly   146 SH--------PTYKAFVFKD-----LSPN--ESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTR 195
            |.        .|...|:..|     |.|.  :.:|...|:::....||.:|:|.:|.|.:.::::
Yeast   119 SQGS
EENDIKKTRLVFMINDDLQSSLDPKLLDQMGFLREVDQWEITNRIVGNGTFGHVLITHNSK 183

  Fly   196 -----TC---QQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHPCVVRM-HDIVDKPD 251
                 .|   :.:|:||:|..             |::...||:|:..|.||.:::: |...|:.:
Yeast   184 ERDEDVCYHPENYAVKIIKLK-------------PNKFDKEARILLRLDHPNIIKVYHTFCDRNN 235

  Fly   252 SVYMVLEFMRGGDLLNRIISNKLL---SEDISKLYFYQMCHAVKYLHDRGITHRDLKPDNVLLET 313
            .:|:..:.:.||||.:.:.....|   ||..|.|..:|:..|:.||||:.|.|||||.||:||.|
Yeast   236 HLYIFQDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCT 300

  Fly   314 NDEETLLKVSDFGLSKFVQKDSV-MRTLCGTPLYVAPEVLITGGREA--------------YTKK 363
            .:..|.:.::|||::|.:..:.. |.|:.|||.|.||||.....|:|              |..|
Yeast   301 PEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQRGYDSK 365

  Fly   364 VDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQI----KKGRFAYGHPSWKSVSQRAKLLINQMLIV 424
            .|:|||||:....|:|..||   ||..:.:.|    |.|:..:....|..||..||..:..:|..
Yeast   366 CDLWSLGVITHIMLTGISPF---YGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQT 427

  Fly   425 DPERRPSIDDVLQSSWLRDAPMLQKAKRLMKLD 457
            |..:|.:....|:..|:        ||.|.:|:
Yeast   428 DVVKRLNSKQGLKHIWI--------AKHLSQLE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 21/82 (26%)
STKc_Chk2 167..441 CDD:270986 91/304 (30%)
S_TKc 174..441 CDD:214567 90/297 (30%)
MEK1NP_014996.3 FHA 28..122 CDD:238017 19/67 (28%)
STKc_CAMK 160..443 CDD:270687 90/298 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002433
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1619
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.