DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CPK29

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_974150.2 Gene:CPK29 / 843936 AraportID:AT1G76040 Length:561 Species:Arabidopsis thaliana


Alignment Length:320 Identity:100/320 - (31%)
Similarity:167/320 - (52%) Gaps:27/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMK 233
            :::..|.::::||.|.:|:.....|....:::|.|.:.|..|...:      |.:.|..|..|::
plant   107 DLSALYDLHKELGRGQFGITYKCTDKSNGREYACKSISKRKLIRRK------DIEDVRREVMILQ 165

  Fly   234 NLS-HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDR 297
            :|: .|.:|......:..|::::|:|...||:|.:|||.....||..:...|.|:.:.|...|..
plant   166 HLTGQPNIVEFRGAYEDKDNLHLVMELCSGGELFDRIIKKGSYSEKEAANIFRQIVNVVHVCHFM 230

  Fly   298 GITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLITGGREAYTK 362
            |:.||||||:|.||.:|:|::.:|.:|||||.|:::..|.|.:.|:..|||||||    ...|.|
plant   231 GVVHRDLKPENFLLVSNEEDSPIKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVL----HRNYGK 291

  Fly   363 KVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPE 427
            ::|:||.||:|:..|||..||..|......:.|.:|:.......|.::|:.||.||.:|||.||:
plant   292 EIDVWSAGVMLYILLSGVPPFWGETEKTIFEAILEGKLDLETSPWPTISESAKDLIRKMLIRDPK 356

  Fly   428 RRPSIDDVLQSSWLRDAPMLQK---------------AKRLMKLDGMEIEEENFLEPPTK 472
            :|.:..:.|:..|:.|..:..|               ..:|.|| .:::..||..|...|
plant   357 KRITAAEALEHPWMTDTKISDKPINSAVLVRMKQFRAMNKLKKL-ALKVIAENLSEEEIK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 90/272 (33%)
S_TKc 174..441 CDD:214567 90/267 (34%)
CPK29NP_974150.2 S_TKc 112..370 CDD:214567 90/267 (34%)
STKc_CAMK 112..369 CDD:270687 90/266 (34%)
PTZ00184 405..548 CDD:185504 4/11 (36%)
EFh 417..476 CDD:238008
EFh 489..549 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.