DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and CDPK2

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:312 Identity:100/312 - (32%)
Similarity:162/312 - (51%) Gaps:25/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PNESIGLPEE---INKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSD 221
            |:.:: ||.:   :...|.:.:|||.|.:|...|..:..|...:|.|.:.|..|      ....|
plant    10 PSNTV-LPYQTPRLRDHYLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKL------VCRED 67

  Fly   222 PDRVLNEAKIMKNLS-HPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFY 285
            .:.|..|.:||.:|| ||.|||:....:....|::|:|...||:|.:||:|....||..:.....
plant    68 YEDVWREIQIMHHLSEHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGHFSEREAVKLIK 132

  Fly   286 QMCHAVKYLHDRGITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPE 350
            .:...|:..|..|:.||||||:|.|.::..::..||.:|||||.|.:....:..:.|:|.|||||
plant   133 TILGVVEACHSLGVMHRDLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYVAPE 197

  Fly   351 VLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAK 415
            ||    ::.|..::|:||.||:|:..|||..||..|..:...:||.:|:..:....|.::|:.||
plant   198 VL----KKCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQGKLDFKSDPWPTISEAAK 258

  Fly   416 LLINQMLIVDPERRPSIDDVLQSSWLRD---AP-------MLQKAKRLMKLD 457
            .||.:||...|::|.|..:.|...|:.|   ||       :|.:.|:..:::
plant   259 DLIYKMLERSPKKRISAHEALCHPWIVDEQAAPDKPLDPAVLSRLKQFSQMN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 92/277 (33%)
S_TKc 174..441 CDD:214567 91/267 (34%)
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 91/267 (34%)
Pkinase 26..284 CDD:278497 91/267 (34%)
PTZ00184 320..462 CDD:185504
EFh 332..391 CDD:238008
EFh 404..463 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.