DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lok and AT1G34300

DIOPT Version :9

Sequence 1:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_174690.1 Gene:AT1G34300 / 840330 AraportID:AT1G34300 Length:829 Species:Arabidopsis thaliana


Alignment Length:348 Identity:90/348 - (25%)
Similarity:144/348 - (41%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FVFKDLSPNESIGLPEEINKTYYVNRKLGSGAYGLV-RLVYDTRTCQQFAMKIVKKNMLSGARPS 216
            |.:|:|         :...|::  ..|||:|.:|.| |.|...||       :|....|.|....
plant   474 FTYKEL---------QRCTKSF--KEKLGAGGFGTVYRGVLTNRT-------VVAVKQLEGIEQG 520

  Fly   217 TNFSDPDRVLNEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISK 281
            ..     :...|...:.:..|..:||:.....:.....:|.||||.|.|     .|.|.:.|.:|
plant   521 EK-----QFRMEVATISSTHHLNLVRLIGFCSQGRHRLLVYEFMRNGSL-----DNFLFTTDSAK 575

  Fly   282 LYFYQ--------MCHAVKYLHDR---GITHRDLKPDNVLLETNDEETLLKVSDFGLSKFVQ-KD 334
            ...::        ....:.|||:.   .|.|.|:||:|:|:   |:....|||||||:|.:. ||
plant   576 FLTWEYRFNIALGTAKGITYLHEECRDCIVHCDIKPENILV---DDNFAAKVSDFGLAKLLNPKD 637

  Fly   335 S--VMRTLCGTPLYVAPEVLITGGREAYTKKVDIWSLGVVLFTCLSGTLPFS-------DEYGTP 390
            :  .|.::.||..|:|||.|   .....|.|.|::|.|:||...:||...|.       .::...
plant   638 NRYNMSSVRGTRGYLAPEWL---ANLPITSKSDVYSYGMVLLELVSGKRNFDVSEKTNHKKFSIW 699

  Fly   391 AAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSIDDVLQ----SSWLRDAPMLQK-- 449
            |.::.:||              ..|.:::..|..|  :...::.|::    |.|......||:  
plant   700 AYEEFEKG--------------NTKAILDTRLSED--QTVDMEQVMRMVKTSFWCIQEQPLQRPT 748

  Fly   450 -AKRLMKLDGMEIEEENFLEPPT 471
             .|.:..|:|: .|.:|.|.|.|
plant   749 MGKVVQMLEGI-TEIKNPLCPKT 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lokNP_477219.1 FHA 39..156 CDD:238017 1/2 (50%)
STKc_Chk2 167..441 CDD:270986 76/299 (25%)
S_TKc 174..441 CDD:214567 75/292 (26%)
AT1G34300NP_174690.1 B_lectin 36..142 CDD:390234
STKc_IRAK 490..759 CDD:270968 79/307 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.